DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATP1B4 and CG33310

DIOPT Version :9

Sequence 1:NP_001135919.1 Gene:ATP1B4 / 23439 HGNCID:808 Length:357 Species:Homo sapiens
Sequence 2:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster


Alignment Length:257 Identity:46/257 - (17%)
Similarity:92/257 - (35%) Gaps:78/257 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   157 RPFAHSLNFNFNVSEPDTWQH-------YVISLNGFLQGYNDSLQEEMNVDCP------PGQYFI 208
            |.|.:.::..:.:..|..|.:       |::.:..|...:.|.::::.:...|      |...|.
  Fly   586 RLFFNKIHGKYKLRRPSHWLYTLVFSVLYILFVIIFSMAWFDFIKDDASRKVPMIKMAQPFISFT 650

Human   209 QDGNEDEDKKACQF----KRSFLKNCSGL--------------------EDPTFGYSTGQPCILL 249
            ..|.. .:.||..|    ....::..:|:                    .:..|||.:|:||:.|
  Fly   651 PIGPR-TNPKAVSFDPRNSTEVMEKYAGIMALLEKYGDYGHNPRFGTCTANEKFGYPSGEPCVFL 714

Human   250 KMNRIVGFR--PELGDPVKVSCKVQ----------------------------RGDENDIRSISY 284
            |:|||:||:  |.:.....|..|:.                            |.|::....|.:
  Fly   715 KVNRIIGFKTEPYINSDELVKAKIDEVEFTALKRLLENTTTEEGHLNRTWITCRSDKDKNVLIEF 779

Human   285 YPESA--------SFDLRYYPYYGKLTHV--NYTSPLVAMHFTDVVKNQAVPVQCQLKGKGV 336
            :||.|        ...:.|....||.:..  |..:.:||:...::..|:.|.:.|::..:.:
  Fly   780 HPEPAIRTEYTDIEEKIEYIANEGKKSFFGPNDVNRIVALKIKNLKANERVHINCKMWAQNI 841

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATP1B4NP_001135919.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 15..80
Na_K-ATPase 82..351 CDD:306737 46/257 (18%)
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 31/139 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160445
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11523
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.