DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TARDBP and SPOM_SPAC222.18

DIOPT Version :10

Sequence 1:NP_031401.1 Gene:TARDBP / 23435 HGNCID:11571 Length:414 Species:Homo sapiens
Sequence 2:NP_001343068.1 Gene:SPOM_SPAC222.18 / 9407033 PomBaseID:SPAC222.18 Length:111 Species:Schizosaccharomyces pombe


Alignment Length:61 Identity:15/61 - (24%)
Similarity:26/61 - (42%) Gaps:12/61 - (19%)


- Green bases have known domain annotations that are detailed below.


Human   201 DMTEDELREFFSQYGDVMDVFIP----KPFRAFAFVTF--------ADDQIAQSLCGEDLI 249
            ||....|.:.|.::|.::...||    .....:|||.|        |.:::..:..|.|:|
pombe    28 DMRARTLGQAFEKWGRIVRCDIPISSNPQAHRYAFVEFEEREKAELAHEKMRNAKIGNDII 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TARDBPNP_031401.1 TDP43_N 4..77 CDD:465833
Nuclear localization signal. /evidence=ECO:0000269|PubMed:18957508 82..98
RRM1_TDP43 105..178 CDD:409760
RRM2_TDP43 191..261 CDD:409761 15/61 (25%)
Interaction with UBQLN2. /evidence=ECO:0000269|PubMed:23541532 216..414 10/46 (22%)
Nuclear export signal. /evidence=ECO:0000269|PubMed:18957508 239..250 3/11 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 261..303
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 341..373
SPOM_SPAC222.18NP_001343068.1 RRM_SF 19..94 CDD:473069 15/61 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.