DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TARDBP and SLIRP2

DIOPT Version :10

Sequence 1:NP_031401.1 Gene:TARDBP / 23435 HGNCID:11571 Length:414 Species:Homo sapiens
Sequence 2:NP_649808.1 Gene:SLIRP2 / 41021 FlyBaseID:FBgn0037602 Length:91 Species:Drosophila melanogaster


Alignment Length:73 Identity:26/73 - (35%)
Similarity:40/73 - (54%) Gaps:1/73 - (1%)


- Green bases have known domain annotations that are detailed below.


Human   100 VQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQ 164
            |:.:..|.|..|||....::|:.|||.:|.|...:|..|.:.|.||.:|||.|::.:......:|
  Fly     6 VRSSYKLFVGNLPWTIGSKELRTYFSKYGHVANAEVVFDRQLGLSKHYGFVVFSQRDAFNSASNQ 70

Human   165 R-HMIDGR 171
            . |.:|||
  Fly    71 NTHFLDGR 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TARDBPNP_031401.1 TDP43_N 4..77 CDD:465833
Nuclear localization signal. /evidence=ECO:0000269|PubMed:18957508 82..98
RRM1_TDP43 105..178 CDD:409760 25/68 (37%)
RRM2_TDP43 191..261 CDD:409761
Interaction with UBQLN2. /evidence=ECO:0000269|PubMed:23541532 216..414
Nuclear export signal. /evidence=ECO:0000269|PubMed:18957508 239..250
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 261..303
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 341..373
SLIRP2NP_649808.1 RRM_SF 11..83 CDD:473069 25/68 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.