DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TARDBP and SPAC328.05

DIOPT Version :9

Sequence 1:NP_031401.1 Gene:TARDBP / 23435 HGNCID:11571 Length:414 Species:Homo sapiens
Sequence 2:NP_594207.3 Gene:SPAC328.05 / 2542567 PomBaseID:SPAC328.05 Length:464 Species:Schizosaccharomyces pombe


Alignment Length:259 Identity:51/259 - (19%)
Similarity:88/259 - (33%) Gaps:70/259 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    69 GNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMV 133
            |.|||:....:.|.|....:.:.||....:..:....|.|..||:....||||:.|...|.|:..
pombe   144 GRLVYIREDREQNARFGSSSVSPSASSNGKDSEPDRQLFVGNLPYNVRWQDLKDLFRQAGSVIRA 208

Human   134 QVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMID--GRWCDCKLPNSKQSQDEPLR------- 189
            .::.: :.|.|:|.|.|..:..:..:..:...|..|  ||..:.:|......:.:|..       
pombe   209 DIQMN-QEGRSRGIGIVVMSSMKEAMHAIQMLHNTDFMGRTLEVRLDRFAHHKSKPYSTHGNGYT 272

Human   190 ------------------------------------SRKVFVGRCTEDMTEDELREFFSQYGDVM 218
                                                |..::||......::..|.:.|:..|.|:
pombe   273 FPAEMQMTTSSTYLPMLGANTQVEDLVYHAYPHGPCSDCIYVGNLPWATSDRNLLDLFTDIGSVI 337

Human   219 DVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSG--RFGGNP 280
                    ||         :||....|..   ||..|  ...|.::::...:|:..  |:||.|
pombe   338 --------RA---------RIAYEPTGRS---KGFGV--VQFENENDAASSIEKLNGYRYGGRP 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TARDBPNP_031401.1 TDP43_N 4..77 CDD:376118 4/7 (57%)
Nuclear localization signal. /evidence=ECO:0000269|PubMed:18957508 82..98 3/15 (20%)
RRM1_TDP43 105..181 CDD:240767 21/77 (27%)
RRM2_TDP43 191..261 CDD:240768 14/69 (20%)
Interaction with UBQLN2. /evidence=ECO:0000269|PubMed:23541532 216..414 15/67 (22%)
Nuclear export signal. /evidence=ECO:0000269|PubMed:18957508 239..250 3/10 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 261..303 6/22 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 341..373
SPAC328.05NP_594207.3 RRM 71..387 CDD:223796 51/259 (20%)
RRM_SF 79..150 CDD:240668 4/5 (80%)
RRM3_hnRNPM_like 181..252 CDD:240833 20/71 (28%)
RRM_SF 312..385 CDD:302621 20/90 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.