Sequence 1: | NP_031401.1 | Gene: | TARDBP / 23435 | HGNCID: | 11571 | Length: | 414 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_594207.3 | Gene: | SPAC328.05 / 2542567 | PomBaseID: | SPAC328.05 | Length: | 464 | Species: | Schizosaccharomyces pombe |
Alignment Length: | 259 | Identity: | 51/259 - (19%) |
---|---|---|---|
Similarity: | 88/259 - (33%) | Gaps: | 70/259 - (27%) |
- Green bases have known domain annotations that are detailed below.
Human 69 GNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMV 133
Human 134 QVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMID--GRWCDCKLPNSKQSQDEPLR------- 189
Human 190 ------------------------------------SRKVFVGRCTEDMTEDELREFFSQYGDVM 218
Human 219 DVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSG--RFGGNP 280 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
TARDBP | NP_031401.1 | TDP43_N | 4..77 | CDD:376118 | 4/7 (57%) |
Nuclear localization signal. /evidence=ECO:0000269|PubMed:18957508 | 82..98 | 3/15 (20%) | |||
RRM1_TDP43 | 105..181 | CDD:240767 | 21/77 (27%) | ||
RRM2_TDP43 | 191..261 | CDD:240768 | 14/69 (20%) | ||
Interaction with UBQLN2. /evidence=ECO:0000269|PubMed:23541532 | 216..414 | 15/67 (22%) | |||
Nuclear export signal. /evidence=ECO:0000269|PubMed:18957508 | 239..250 | 3/10 (30%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 261..303 | 6/22 (27%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 341..373 | ||||
SPAC328.05 | NP_594207.3 | RRM | 71..387 | CDD:223796 | 51/259 (20%) |
RRM_SF | 79..150 | CDD:240668 | 4/5 (80%) | ||
RRM3_hnRNPM_like | 181..252 | CDD:240833 | 20/71 (28%) | ||
RRM_SF | 312..385 | CDD:302621 | 20/90 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |