DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TARDBP and tif307

DIOPT Version :10

Sequence 1:NP_031401.1 Gene:TARDBP / 23435 HGNCID:11571 Length:414 Species:Homo sapiens
Sequence 2:NP_595727.1 Gene:tif307 / 2540819 PomBaseID:SPBC18H10.03 Length:282 Species:Schizosaccharomyces pombe


Alignment Length:89 Identity:28/89 - (31%)
Similarity:44/89 - (49%) Gaps:10/89 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    97 KRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKV 161
            ||....::.|.|..|...|.|::|::.|..||.:..|.:.||.:||.:|||.||.:.:.:..:|.
pombe   195 KRERDDSATLRVTNLSDDTREEELRDLFRRFGGIQRVYLAKDKETGRAKGFAFVSYYDRDCAIKA 259

Human   162 MSQRHMIDG-RW------CDCKLP 178
               |..:|| .|      |:...|
pombe   260 ---RDRLDGYGWNNLILRCEFSKP 280

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
TARDBPNP_031401.1 TDP43_N 4..77 CDD:465833