DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TMED3 and CHOp24

DIOPT Version :9

Sequence 1:NP_031390.1 Gene:TMED3 / 23423 HGNCID:28889 Length:217 Species:Homo sapiens
Sequence 2:NP_001284862.1 Gene:CHOp24 / 31382 FlyBaseID:FBgn0029709 Length:208 Species:Drosophila melanogaster


Alignment Length:217 Identity:74/217 - (34%)
Similarity:107/217 - (49%) Gaps:15/217 - (6%)


- Green bases have known domain annotations that are detailed below.


Human     1 MGSTVPRSASVLLL---LLLLRRAEQPCGAELTFELPDNA--KQCFHEEVEQGVKFSLDYQVITG 60
            |.||:   |.||||   ||:|      |.....|.:..:|  ::||.|.||.|.||.:.::||.|
  Fly     1 MESTL---AKVLLLVGSLLIL------CRTSHAFIVSVDAHNEECFFENVEGGTKFGVTFEVIDG 56

Human    61 GHYDVDCYVEDPQGNTIYRETKKQYDSFTYRAEVKGVYQFCFSNEFSTFSHKTVYFDFQVGDEPP 125
            |..|||..:..|..:.::...|:....:|:.|..||.|..||:||.|:.:.|.|.|...|||.|.
  Fly    57 GFLDVDIKISGPDNHVMHESEKESSGKYTFVAPAKGTYTVCFNNERSSMTPKLVMFSIDVGDAPQ 121

Human   126 ILPDM-GNRVTALTQMESACVTIHEALKTVIDSQTHYRLREAQDRARAEDLNSRVSYWSVGETIA 189
            ..|.. |......|::|.....:...|.:|...|.:..:|:...|:..|:.||||..||..|.:.
  Fly   122 RAPGAPGEEEVGHTKLEDMIRELSGTLTSVKHEQEYMHVRDKIHRSVNENTNSRVVLWSTFEALV 186

Human   190 LFVVSFSQVLLLKSFFTEKRPI 211
            |.:::..||..||.||..||.:
  Fly   187 LVLMTVGQVYYLKRFFEVKRVV 208

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
TMED3NP_031390.1 EMP24_GP25L 28..205 CDD:307313 58/179 (32%)
COPI vesicle coat-binding. /evidence=ECO:0000255 204..217 4/8 (50%)