DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FBXO46 and Pdfr

DIOPT Version :9

Sequence 1:NP_001073938.1 Gene:FBXO46 / 23403 HGNCID:25069 Length:603 Species:Homo sapiens
Sequence 2:NP_001245501.1 Gene:Pdfr / 31234 FlyBaseID:FBgn0260753 Length:738 Species:Drosophila melanogaster


Alignment Length:248 Identity:52/248 - (20%)
Similarity:77/248 - (31%) Gaps:86/248 - (34%)


- Green bases have known domain annotations that are detailed below.


Human   225 SRVAEAVAHFEAQRDSPPTKGLRKEERPGPGPG-------------EVRIAFRISNGREPRAPDS 276
            |.:.:......|||.   |:.||:....||.|.             |...:..::.||.|...|.
  Fly    74 SNILDCGGCISAQRF---TRLLRQSGSSGPSPSAPTAGTFESKSMLEPTSSHSLATGRVPLLHDF 135

Human   277 GLPSGGGGRPGCAYPGSPGPGARAKDKITCDLYQLISPS-RDALP-SNVEFLLARADEASEGD-- 337
            ...:            :..||....|.:.......:.|: .|||| |:.|.:|...:.::..:  
  Fly   136 DAST------------TESPGTYVLDGVARVAQLALEPTVMDALPDSDTEQVLGNLNSSAPWNLT 188

Human   338 --SPAPARPE----------------------DT----PPAPPPPPARDCGASGFHVDVVVTGV- 373
              |.|....|                      ||    ||.|....||.....|||      || 
  Fly   189 LASAAATNFENCSALFVNYTLPQTGLYCNWTWDTLLCWPPTPAGVLARMNCPGGFH------GVD 247

Human   374 -----VDECIFFGKDGTKNVKEETVCLTVSPEEPPPPGQLFFLQNRGPDGPPE 421
                 :.:|...|:.|::          .:..|..|||...:    ||...||
  Fly   248 TRKFAIRKCELDGRWGSR----------PNATEVNPPGWTDY----GPCYKPE 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FBXO46NP_001073938.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..63
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..163
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 235..301 16/78 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 326..360 11/63 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 396..440 8/26 (31%)
F-box-like 473..>507 CDD:289689
PdfrNP_001245501.1 HRM 213..272 CDD:280888 16/74 (22%)
7tm_4 306..563 CDD:304433
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.