DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CTDNEP1 and Fcp1

DIOPT Version :10

Sequence 1:NP_056158.2 Gene:CTDNEP1 / 23399 HGNCID:19085 Length:244 Species:Homo sapiens
Sequence 2:NP_611934.1 Gene:Fcp1 / 37925 FlyBaseID:FBgn0035026 Length:880 Species:Drosophila melanogaster


Alignment Length:174 Identity:45/174 - (25%)
Similarity:72/174 - (41%) Gaps:21/174 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    55 RLAQVKRKILVLDLDETLIHSHHDGVLRPTVRPGTPPDFILKV----VIDKHPVRFFVHKRPHVD 115
            ||...::.:|::|||:|:||:.:|          |.||.|..:    :...|...:....||...
  Fly   201 RLLADRKLVLLVDLDQTVIHTTND----------TVPDNIKGIYHFQLYGPHSPWYHTRLRPGTA 255

Human   116 FFLEVVSQWYELVVFTASMEIYGSAVADKLDNSRSILKRRYYRQHCTLELGSYIKDLSVVHSDLS 180
            .|||.:||.|||.:.|.....|...:|..||........|...:.......|...:|..:..:..
  Fly   256 EFLERMSQLYELHICTFGARNYAHMIAQLLDPEGKFFSHRILSRDECFNATSKTDNLKALFPNGD 320

Human   181 SIV-ILDNSPGAYRSHPDNAIPIKSW--FSDPSDTALLNLLPML 221
            |:| |:|:....: :...|.|.:|.:  |....|   :|..|.|
  Fly   321 SMVCIIDDREDVW-NMASNLIQVKPYHFFQHTGD---INAPPGL 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CTDNEP1NP_056158.2 HIF-SF_euk 61..229 CDD:274055 43/168 (26%)
Fcp1NP_611934.1 Biotinyl_lipoyl_domains 59..142 CDD:448245
FCP1_euk 202..348 CDD:131304 39/156 (25%)
PRK08581 373..>530 CDD:236304
BRCT_CTDP1 578..674 CDD:349361
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.