DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC17 and CG4956

DIOPT Version :9

Sequence 1:NP_056151.2 Gene:ZDHHC17 / 23390 HGNCID:18412 Length:632 Species:Homo sapiens
Sequence 2:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster


Alignment Length:345 Identity:83/345 - (24%)
Similarity:123/345 - (35%) Gaps:103/345 - (29%)


- Green bases have known domain annotations that are detailed below.


Human   302 RQKVM-LGTPFLVIWLVGFIADLNIDSWLIKGLMYGGVWATVQFLSKSFFDHSMHSALPLGIYLA 365
            |.||| |..||..|:|:..|           ||::  |:.....|.:....|.:           
  Fly    34 RIKVMGLLHPFCAIFLLCLI-----------GLLF--VYELCYVLPQITDPHGI----------- 74

Human   366 TKFWMYVTWFFWFWNDLNFLFIHLPFLANSVALFYNFGKSWKSDPGIIKATEEQKKKTIVELAET 430
               |..:.||...:..:|.|                 |..|.   |.:..|.........:....
  Fly    75 ---WHKLCWFMGIYTVINIL-----------------GNWWL---GCMTNTSVDSLVLERQYPVA 116

Human   431 GSLDLSIFCSTCLIRKPVRSKHCGVCNRCIAKFDHHCPWVGNCVGAGNHRYFMGYLFFLLFMICW 495
            |...|..:||||....|.||.||.:||.||.|.||||.:..:|:|..|.|||:.:||.|.|....
  Fly   117 GEAHLWHYCSTCQKLVPPRSWHCSLCNICILKRDHHCTFFASCIGHKNQRYFLAFLFHLSFGSGQ 181

Human   496 -MIYGCISYWG------------LHCETTYTKDGFWTYITQIATCSPWMFWMFLNSVFHFMWVAV 547
             ::|..|..|.            :..:||...|..|.|    ...:.:...:||..|..||:|..
  Fly   182 ALVYNGILNWTNKAFLVVDPLLLMFQDTTQDADFKWKY----TIANLFKLNLFLFGVPLFMFVFQ 242

Human   548 LLMCQMYQISCLGITTNERMNARRYKHFKVTTTSIESPFNHGCVRNIIDFFEF-----RCCGLFR 607
            ::|  :|:            |:..||       .::..::.|..||    |:.     |....|.
  Fly   243 MIM--VYR------------NSTCYK-------MLDRSYDVGWRRN----FDMVLGKRRFWIFFS 282

Human   608 PVI--------VDWTRQYTI 619
            |.|        ..|.::.|:
  Fly   283 PTISSPLPTDGTQWFQKQTV 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC17NP_056151.2 Necessary and sufficient for interaction with DNAJC5 and SNAP25. /evidence=ECO:0000250|UniProtKB:Q80TN5 11..305 1/2 (50%)
ANK repeat 89..120 CDD:293786
Ank_2 94..187 CDD:403870
ANK repeat 122..154 CDD:293786
ANK repeat 156..187 CDD:293786
Ank_2 161..255 CDD:403870
ANK repeat 189..221 CDD:293786
ANK repeat 224..255 CDD:293786
Ank_2 229..>286 CDD:423045
DHHC 438..568 CDD:396215 44/142 (31%)
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 45/145 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.