DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ZDHHC17 and CG17198

DIOPT Version :9

Sequence 1:	NP_056151.2	Gene:	ZDHHC17 / 23390	HGNCID:	18412	Length:	632	Species:	Homo sapiens
Sequence 2:	NP_001287532.1	Gene:	CG17198 / 43110	FlyBaseID:	FBgn0039366	Length:	299	Species:	Drosophila melanogaster

Alignment Length:	51	Identity:	27/51 - (52%)
Similarity:	33/51 - (64%)	Gaps:	0/51 - (0%)

- Green bases have known domain annotations that are detailed below.

Human   438 FCSTCLIRKPVRSKHCGVCNRCIAKFDHHCPWVGNCVGAGNHRYFMGYLFF 488
            ||..|....|.||.||.:|:.||.|.||||.:||||||..|.|||:.:.|:
  Fly   117 FCKICQRNVPPRSWHCNICDACILKRDHHCNFVGNCVGHNNQRYFIWFSFY 167

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ZDHHC17	NP_056151.2	Necessary and sufficient for interaction with DNAJC5 and SNAP25. /evidence=ECO:0000250\|UniProtKB:Q80TN5	11..305
		ANK repeat	89..120	CDD:293786
		Ank_2	94..187	CDD:403870
		ANK repeat	122..154	CDD:293786
		ANK repeat	156..187	CDD:293786
		Ank_2	161..255	CDD:403870
		ANK repeat	189..221	CDD:293786
		ANK repeat	224..255	CDD:293786
		Ank_2	229..>286	CDD:423045
		DHHC	438..568	CDD:396215	27/51 (53%)
CG17198	NP_001287532.1	zf-DHHC	43..>176	CDD:303066	27/51 (53%)
CG17198	NP_001287532.1	zf-DHHC	111..252	CDD:279823	27/51 (53%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5273
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810