Sequence 1: | NP_056151.2 | Gene: | ZDHHC17 / 23390 | HGNCID: | 18412 | Length: | 632 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_648928.1 | Gene: | CG13029 / 39886 | FlyBaseID: | FBgn0036670 | Length: | 288 | Species: | Drosophila melanogaster |
Alignment Length: | 251 | Identity: | 65/251 - (25%) |
---|---|---|---|
Similarity: | 78/251 - (31%) | Gaps: | 100/251 - (39%) |
- Green bases have known domain annotations that are detailed below.
Human 349 FFDHSMHSALPLGIYLATKFWMYVTWFFWFWNDLNFLFIHLPFLANSVALFYNFG--KSWKSDPG 411
Human 412 IIKATEEQKKKTIVELAETGSLDLSIFCSTCLIRKPVRSKHCGVCNRCIAKFDHHCPWVGNCVGA 476
Human 477 GNHRYFMGYL-----------------------------------FFLLF--MICWM-------- 496
Human 497 --IYGCI------SYW--GLHCETT-YT-------------------KDGFWTYIT 522 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ZDHHC17 | NP_056151.2 | Necessary and sufficient for interaction with DNAJC5 and SNAP25. /evidence=ECO:0000250|UniProtKB:Q80TN5 | 11..305 | ||
ANK repeat | 89..120 | CDD:293786 | |||
Ank_2 | 94..187 | CDD:403870 | |||
ANK repeat | 122..154 | CDD:293786 | |||
ANK repeat | 156..187 | CDD:293786 | |||
Ank_2 | 161..255 | CDD:403870 | |||
ANK repeat | 189..221 | CDD:293786 | |||
ANK repeat | 224..255 | CDD:293786 | |||
Ank_2 | 229..>286 | CDD:423045 | |||
DHHC | 438..568 | CDD:396215 | 43/160 (27%) | ||
CG13029 | NP_648928.1 | zf-DHHC | 100..236 | CDD:279823 | 38/148 (26%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |