DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC17 and app

DIOPT Version :10

Sequence 1:NP_056151.2 Gene:ZDHHC17 / 23390 HGNCID:18412 Length:632 Species:Homo sapiens
Sequence 2:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster


Alignment Length:344 Identity:81/344 - (23%)
Similarity:138/344 - (40%) Gaps:105/344 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   339 WATVQFLSKSFFDHSMHSALPLGIYLATKFWMYVTWFFWFWNDLNFLFIHLPFLANSV------- 396
            |......:|.:.|..:.||...|::       |:|..........|.....||||:|:       
  Fly    22 WELFAGRNKFYCDGLLMSAPHTGVF-------YLTCILITGTSALFFAFDCPFLADSINPAIPIV 79

Human   397 -ALFYNFG-----KSWKSDPGII-KATEEQ-----------------------KKKTIVELAETG 431
             |:.|.|.     ::..:|||:| :|:.::                       :.|.::...:|.
  Fly    80 GAVLYFFTMSSLLRTTFTDPGVIPRASNDEAAYIEKQIEVPNSLNSPTYRPPPRTKEVLVKGQTV 144

Human   432 SLDLSIFCSTCLIRKPVRSKHCGVCNRCIAKFDHHCPWVGNCVGAGNHRYFMGYLFFLLFMICWM 496
            .|.   :|.||.|.:|.|:.||.:|:.|:.:|||||||||||||..|:|:|..:|..|.|:..: 
  Fly   145 KLK---YCFTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGKRNYRFFYLFLVSLAFLAVF- 205

Human   497 IYGC-ISYWGLHCETTYTKDGFWTYITQIATCSPWMFWMFLNSVFHFMWVAVLLMCQMYQISCLG 560
            |:.| :::..|..:..:.       :..:...:|:.             |.|:.:|.....|.:|
  Fly   206 IFSCSVTHLVLLMKKEHE-------VFNVIKAAPFT-------------VIVVFICFFSIWSVIG 250

Human   561 I------------TTNERMNARRYKHFKVTTTS-----IESPFNHGCVRNIIDFFEFRC----CG 604
            :            ||||.:        |.:.:|     .::|::.|   ||.    ..|    ||
  Fly   251 LAGFHTYLTTSDQTTNEDL--------KGSFSSKGGPRTQNPYSRG---NIC----LNCCHILCG 300

Human   605 LFRPVIVDWTRQYTIEYDQ 623
            ...|.::|.....|.|:.|
  Fly   301 PMTPSLIDRRGIATDEFIQ 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC17NP_056151.2 Necessary and sufficient for interaction with DNAJC5 and SNAP25. /evidence=ECO:0000250|UniProtKB:Q80TN5 11..305
ANKYR 52..307 CDD:440430
ANK repeat 89..120 CDD:293786
ANK repeat 122..154 CDD:293786
ANK repeat 156..187 CDD:293786
ANK repeat 189..221 CDD:293786
ANK repeat 224..255 CDD:293786
DHHC 438..568 CDD:396215 42/142 (30%)
appNP_648561.2 DHHC 146..270 CDD:396215 43/155 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.