DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC17 and CG8314

DIOPT Version :10

Sequence 1:NP_056151.2 Gene:ZDHHC17 / 23390 HGNCID:18412 Length:632 Species:Homo sapiens
Sequence 2:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster


Alignment Length:241 Identity:70/241 - (29%)
Similarity:101/241 - (41%) Gaps:57/241 - (23%)


- Green bases have known domain annotations that are detailed below.


Human   385 LFIHLPFLANSVALFYNFGKSWKSDPGII---KATEEQKKKTIVELAETGSLDLSIF--CSTCLI 444
            :|..|.|||     |.:..::..||||.:   .||:|.       :.:.|..:..:|  |..|..
  Fly    76 IFQALAFLA-----FASHIRTMLSDPGAVPRGNATKEM-------IEQMGYREGQMFYKCPKCCS 128

Human   445 RKPVRSKHCGVCNRCIAKFDHHCPWVGNCVGAGNHRYFMGYLFFL-------LFMICWMIYGCIS 502
            .||.|:.||.||.|||.|.|||||||.||||..|.:||:.:.|::       ||::......|:.
  Fly   129 IKPERAHHCSVCQRCIRKMDHHCPWVNNCVGENNQKYFVLFTFYIASISVHTLFLVLTQFAECVK 193

Human   503 YWGLHCETTYTKDGFWTYITQIATCSPW---------MFWMFLNSVFHFMWVAVLLMCQMYQI-- 556
                         ..|      .||||:         :|..|...:|. ::..::|..|:..|  
  Fly   194 -------------NDW------RTCSPYSPPATIFLLLFLTFEGLMFG-IFTIIMLATQLTAILN 238

Human   557 SCLGITTNERMNARRYKHFKVTTTSIESPFNHGCVRNIIDFFEFRC 602
            ...||...::..||..|  |....||:|.|....:.....|.|..|
  Fly   239 DQTGIEQLKKEEARWAK--KSRLKSIQSVFGRFSLAWFSPFTEPSC 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC17NP_056151.2 Necessary and sufficient for interaction with DNAJC5 and SNAP25. /evidence=ECO:0000250|UniProtKB:Q80TN5 11..305
ANKYR 52..307 CDD:440430
ANK repeat 89..120 CDD:293786
ANK repeat 122..154 CDD:293786
ANK repeat 156..187 CDD:293786
ANK repeat 189..221 CDD:293786
ANK repeat 224..255 CDD:293786
DHHC 438..568 CDD:396215 45/149 (30%)
CG8314NP_611070.1 DHHC 122..249 CDD:396215 44/146 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.