DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AHCYL2 and Ahcy

DIOPT Version :9

Sequence 1:NP_056143.1 Gene:AHCYL2 / 23382 HGNCID:22204 Length:611 Species:Homo sapiens
Sequence 2:NP_001285268.1 Gene:Ahcy / 32471 FlyBaseID:FBgn0014455 Length:432 Species:Drosophila melanogaster


Alignment Length:434 Identity:228/434 - (52%)
Similarity:305/434 - (70%) Gaps:5/434 - (1%)


- Green bases have known domain annotations that are detailed below.


Human   180 SKGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTAVLME 244
            ||.|  :.|.:|..||:||:.|.|||.|||.|||.||:....|||.||:|.||.|:|.|||||:|
  Fly     2 SKPS--YKVADISLAEWGRKAIIIAENEMPGLMACRKKYGPSKPLKGARITGCLHMTVQTAVLIE 64

Human   245 TLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVEGWQP-NMIL 308
            ||..||||.:|::|||:||.:..|||:|.:|.||:|||||:::::.|||::.:.....|| ||||
  Fly    65 TLVELGAQVQWSSCNIFSTQDNAAAAIAATGVPVYAWKGETDEEYMWCIEQTLVFPDGQPLNMIL 129

Human   309 DDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYC 373
            |||||||:.:::|:|...|.|||:.||:.||||.||::.|.|:|.|||:||||||||.||||||.
  Fly   130 DDGGDLTNLVHEKFPQYLKNIKGLSEETTTGVHNLYKMFKEGRLGVPAINVNDSVTKSKFDNLYG 194

Human   374 CRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVTEIDPICALQACMDGFRL 438
            ||||::||:||.||:|..||...|.|||:|||||..|||..|..|.|||:|||.||||.|:|:.:
  Fly   195 CRESLIDGIKRATDVMIAGKVCCVAGYGDVGKGCAQALKGFGGRVIVTEVDPINALQAAMEGYEV 259

Human   439 VKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLRTPELTWERVRSQ 503
            ..:.|..::..|.:|.||.::::|..||.:|.:..||||:||.:.||||..|.........|:.|
  Fly   260 TTMEEASKEASIFVTTTGCRDIITSVHLQQMPDDAIVCNIGHFDIEIDVDWLNANAKEKVNVKPQ 324

Human   504 VDHVIWPDGKRIVLLAEGRLLNLSCS-TVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPK 567
            ||......||.|:|||||||:||.|: ..|:||:|.:.|.|.||.|||:...: :|...|::|||
  Fly   325 VDRYTMQSGKHIILLAEGRLVNLGCAHGHPSFVMSNSFTNQVLAQIELWTKSD-KYAVGVHVLPK 388

Human   568 KMDEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYRY 611
            .:||.||||||......||:||::||.|||:::.|||||::|||
  Fly   389 ILDEEVASLHLEKLGVKLTKLTEKQATYLGVSQTGPFKPDHYRY 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AHCYL2NP_056143.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..184 2/3 (67%)
LISN domain, inhibits interaction with ITPR1. /evidence=ECO:0000269|PubMed:19220705 2..109
AdoHcyase 185..610 CDD:310083 222/426 (52%)
AhcyNP_001285268.1 PRK05476 1..426 CDD:235488 222/426 (52%)
AdoHcyase 6..431 CDD:283003 222/425 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0499
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D371693at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.