DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TNS2 and by

DIOPT Version :9

Sequence 1:XP_006719365.1 Gene:TNS2 / 23371 HGNCID:19737 Length:1428 Species:Homo sapiens
Sequence 2:NP_001163569.1 Gene:by / 41144 FlyBaseID:FBgn0000244 Length:720 Species:Drosophila melanogaster


Alignment Length:647 Identity:197/647 - (30%)
Similarity:288/647 - (44%) Gaps:162/647 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   793 PEGRYGHPGYPALVTYSYGGAVPSYCPAYGRVPHSCGSPGEGRGYPSPGAHSPRAGSISPGSPPY 857
            |:.:|    ||: ..|..|....|....|.:.|   .|.|:...|......:.....:.|...||
  Fly   210 PQRQY----YPS-DGYGIGLKNDSNGTLYRKSP---SSNGKSTKYNYDFEFNLNLDDVRPEPTPY 266

Human   858 P------QSRKLSYEIPTEEG-GDRYPLPGHLASAGPLASA---ESLEPVSWREGPSGHS----T 908
            .      :..:|..::|  :| .:|..:..:..:...|.:.   :.|||:.......|.:    |
  Fly   267 TTRNIHFEDLRLDQDVP--DGVVNRRTMERNYHTINSLETTHKRQQLEPLEQLGAVYGQNHMEET 329

Human   909 LPRSPRDAPCSASSELSGPSTPLHTSSPVQGKESTRRQDTRSPTSAPTQRLSPGEALPPVSQAGT 973
            |.|:.||  .|||:..|..::||                             |...:|.:     
  Fly   330 LTRTRRD--LSASTSTSKSTSPL-----------------------------PAIGVPAI----- 358

Human   974 GKAPELPSGSGPEPLAPSPVSPTFPPSSPSDWPQERSPGGHSDGASPRSPVPTTLPGLRHAPWQG 1038
                             :|.||.:..|:      :|....:::|....:|.||:.|         
  Fly   359 -----------------APASPIYATST------KRVSNPNTNGQQQMTPSPTSRP--------- 391

Human  1039 PRGPPDSPDGSPLTPVPSQMPWLVASPEPPQSSPTPAFPLAASYDTNGLSQPPLPEKRHLPGPGQ 1103
                     .:|..||..:.|:..:|......:||...|..:.|.|                   
  Fly   392 ---------ETPAFPVTPRTPFGASSSSSASLAPTTQLPPESIYQT------------------- 428

Human  1104 QPGPWGPEQASSPARGISHHVTFAPLLSDNVPQTPEPPTQESQSNVKFVQDTSKFWYKPHLSRDQ 1168
                       .|.||:      .|.|.         |.:.|..:|:|.:.:|:|||||:|:|:.
  Fly   429 -----------GPRRGV------PPALQ---------PLEVSADSVQFARSSSQFWYKPNLTRED 467

Human  1169 AIALLKDKDPGAFLIRDSHSFQGAYGLALKVATPPPSAQPWKGDPVEQLVRHFLIETGPKGVKIK 1233
            |||||....||.||:|||.:::.:|||.::|:.|||.:|        :||||||||....||.:|
  Fly   468 AIALLASAQPGTFLVRDSTTYKDSYGLVVRVSQPPPGSQ--------ELVRHFLIEPTKGGVHLK 524

Human  1234 GCPSEPYFGSLSALVSQHSISPISLPCCLRIPSKDPLEETPEAPVPTNMSTAADLLRQGAACSVL 1298
            ||..||.|.||||||.:||||.::|||.||:|.:|.:     .||.........||..|||.:||
  Fly   525 GCDDEPVFTSLSALVFEHSISQLALPCLLRLPDRDIV-----PPVRATTPAQQHLLAHGAATNVL 584

Human  1299 YLTSVETESLTGPQAVARASSAALSCSPRPTPAVVHFKVSAQGITLTDNQRKLFFRRHYPVNSIT 1363
            :|.|.:||||||.:|:.:|........|.|.|..||||||:||||||||.||.|||:||..:.|:
  Fly   585 WLYSCDTESLTGNEAIRKAIRQMYGQQPLPQPTEVHFKVSSQGITLTDNTRKKFFRKHYKADVIS 649

Human  1364 FSSTDPQDRRWTNPDGTTSK--IFGFVAKKPGSPWENVCHLFAELDPDQPAGAIVTFITKVL 1423
            ..:.||::|.||: :|.:.|  ||.|||::..|..:|.||:|.:|...|||.|||:|..:.|
  Fly   650 HCAIDPENRMWTS-EGESDKKTIFAFVARRSHSSTDNQCHVFCDLSVSQPAAAIVSFANRTL 710

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TNS2XP_006719365.1 C1 42..89 CDD:237996
PTPc_motif 199..319 CDD:214649
PTEN_C2 307..434 CDD:287393
SH2_Tensin_like 1155..1268 CDD:198181 60/112 (54%)
PTB_tensin 1292..1424 CDD:269924 66/134 (49%)
byNP_001163569.1 SH2_Tensin_like 454..559 CDD:198181 60/112 (54%)
PTB_tensin 578..711 CDD:269924 66/134 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 138 1.000 Domainoid score I4840
eggNOG 1 0.900 - - E2759_KOG1930
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42255
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45734
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5448
SonicParanoid 1 1.000 - - X1051
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.