DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TNS2 and ptn1

DIOPT Version :9

Sequence 1:XP_006719365.1 Gene:TNS2 / 23371 HGNCID:19737 Length:1428 Species:Homo sapiens
Sequence 2:NP_596312.1 Gene:ptn1 / 2541101 PomBaseID:SPBC609.02 Length:348 Species:Schizosaccharomyces pombe


Alignment Length:247 Identity:61/247 - (24%)
Similarity:102/247 - (41%) Gaps:53/247 - (21%)


- Green bases have known domain annotations that are detailed below.


Human   114 KSLNHSKQRSTLPRSFSLDPLMERRWDLDLTYVTERILAAAFPARPDEQRHRGHLRELAHVLQSK 178
            |.|...|    :.|||:.         ||:.|:|.:::|.:.||....:.:|....::...|.::
pombe    13 KGLKQEK----VNRSFAY---------LDMVYITSKVIAMSTPAAGIHKLYRNDELDVFKYLTTQ 64

Human   179 HRDKYLLFNL--SEKRHDLTRLNPKVQDFGWPELHAPPLDKLCSICKAMETWLSADPQHVVVLYC 241
            .:|.::|.||  .|..:.|....|.|.::|:.:.:.|||..|.:|...|:......|...:|::|
pombe    65 LKDNWILLNLCAEETVYHLELFKPNVINYGFQDHNPPPLLFLWAIVMNMDALFQTQPLLTLVVHC 129

Human   242 KGNKGKLGVIVSAYMHYSKISAG---ADQALATLTMRKFCEDKVATELQPSQRRYISY------- 296
            |..||:.|.::.:|:    ::.|   |.|:|...|.::.......|  ..||.||:.|       
pombe   130 KAGKGRTGTVICSYL----VAFGGLTAKQSLELYTEKRMVRGHGLT--ISSQIRYVYYIEILKQF 188

Human   297 ---------------FSGLLSGSIRMNSSPLFLHYVLIPMLPAFEPGTGFQP 333
                           |......:|:.|||       ||..|.||..|....|
pombe   189 PNYLKAVEFNTGTTFFKSFKCLNIKKNSS-------LILSLHAFSKGRNINP 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TNS2XP_006719365.1 C1 42..89 CDD:237996
PTPc_motif 199..319 CDD:214649 33/144 (23%)
PTEN_C2 307..434 CDD:287393 10/27 (37%)
SH2_Tensin_like 1155..1268 CDD:198181
PTB_tensin 1292..1424 CDD:269924
ptn1NP_596312.1 CDC14 15..201 CDD:225297 48/204 (24%)
PTPc <78..179 CDD:304379 28/106 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2283
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.