DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ANGEL1 and angel

DIOPT Version :9

Sequence 1:NP_001357675.1 Gene:ANGEL1 / 23357 HGNCID:19961 Length:744 Species:Homo sapiens
Sequence 2:NP_477204.1 Gene:angel / 37748 FlyBaseID:FBgn0016762 Length:354 Species:Drosophila melanogaster


Alignment Length:300 Identity:104/300 - (34%)
Similarity:143/300 - (47%) Gaps:37/300 - (12%)


- Green bases have known domain annotations that are detailed below.


Human   221 REWEDFSTQPDAQGLKAGDGPQ--FQFTLMSYNILAQDLMQQSSELYLHCHPDILNWNYRFVNLM 283
            |.|.....|.:      |..|.  ..|.::|||||||||:.:...||:....:.|:|..|..||:
  Fly    48 RRWTSLGNQAE------GRDPHKCSSFKVVSYNILAQDLLLEHLFLYVGIPHEFLSWQRRQQNLL 106

Human   284 QEFQHWDPDILCLQEVQEDHYWEQLEPSLRM---MGFTCFYKRRTGCKTDGCAVCYKPTRFRLLC 345
            :|....|||||||||:|.||. ..|...|||   ......||::|||:|||||:.|..::|.||.
  Fly   107 RELLKLDPDILCLQEMQFDHL-PVLVQRLRMGNGKKLAYVYKKKTGCRTDGCAIVYDSSKFELLD 170

Human   346 ASPVEYFRPGLELLNRDNVGLVLLLQPLVPEGLGQVSVAPLCVANTHILYNPRRGDVKLAQMAIL 410
            ...||.:...:.|||||||.|....:    ....|.......||.||:|:|.:|.||:.||:..:
  Fly   171 HQAVELYDQAVALLNRDNVALFARFR----FKKQQEQQKEFVVATTHLLFNTKRSDVRCAQVERI 231

Human   411 LAEVDKVARLSDGSHCPIILCGDLNSVPDSPLYNFI--RDGELQYHGMPAWKSLALLPRLECNGT 473
            |.|:.     |..:..||:|.||.||:|||....|:  ::|::.....|......::...|  ||
  Fly   232 LEELQ-----SFSTDTPIVLTGDFNSLPDSSPIEFLVGKNGDVDSTACPEPLHFEIIDSGE--GT 289

Human   474 ISAHCN--------LCLLGSCDS----PASASQVAGITGC 501
            .|.:.|        |..|||...    |.|...:..|..|
  Fly   290 ASTYQNEWVIVDYILRSLGSRSRHKLLPLSVYSLPSINRC 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ANGEL1NP_001357675.1 EEP 248..>449 CDD:351117 83/205 (40%)
angelNP_477204.1 EEP 70..351 CDD:294334 97/271 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143749
Domainoid 1 1.000 135 1.000 Domainoid score I4986
eggNOG 1 0.900 - - E1_COG5239
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32251
Inparanoid 1 1.050 134 1.000 Inparanoid score I4594
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D395901at33208
OrthoFinder 1 1.000 - - FOG0002618
OrthoInspector 1 1.000 - - otm40331
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12121
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3577
SonicParanoid 1 1.000 - - X1517
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.890

Return to query results.
Submit another query.