DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TUT4 and Tailor

DIOPT Version :9

Sequence 1:XP_005270733.1 Gene:TUT4 / 23318 HGNCID:28981 Length:1652 Species:Homo sapiens
Sequence 2:NP_001262327.1 Gene:Tailor / 40847 FlyBaseID:FBgn0037470 Length:563 Species:Drosophila melanogaster


Alignment Length:329 Identity:84/329 - (25%)
Similarity:140/329 - (42%) Gaps:83/329 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   986 EYD----------------EKARLCLFGSSKNGFGFRDSDLDICM----------TLEGHENAEK 1024
            |||                :..|:..|||...|.|.|.||||:.:          |.| |..:..
  Fly   239 EYDVIEQDLCKLLSPGFPKQPLRVYKFGSRITGIGNRSSDLDLFVDIGKSGNTFHTFE-HRASNA 302

Human  1025 LNCKEIIENLAKILKRHPGLRNILPITTAKVPIVKFEHRRSGLEGDISLYNTLAQHNTRMLATYA 1089
            ...|  :..:.|........|.|..|..|:|||:|..|..:|:|.||.| |::...||.:|....
  Fly   303 TVAK--LRAMRKFFCDSEDWRLINFIEQARVPIIKTCHLPTGIECDICL-NSMGFCNTNLLKYIF 364

Human  1090 AIDPRVQYLGYTMKVFAKRCDIGDASRGSLSSYAYILMVLYFLQ-QRKPPVIPVLQEIFDGKQIP 1153
            ...|..||:...:|.:.:||.:.:    .:|:|:..|||:|||| |...|.|.:|| |.|...  
  Fly   365 ESQPLTQYMCIYVKNWLERCKLTE----QISTYSITLMVIYFLQLQALLPPIAMLQ-IEDAAN-- 422

Human  1154 QRMVDG-WNAFFFDKT------EELKKRLPSLGKNTESLGELWLGLLR---FYTEEFDFKEYVI- 1207
            |.::.| |...|..|:      ::||..:|.:           .|.||   .|..:||::.::: 
  Fly   423 QAVLVGPWVVNFAQKSFSELGLQQLKATVPVI-----------KGFLRNFFAYFAKFDYEHFLVC 476

Human  1208 ------SIRQKKLLTTFEKQWTS-------------KCIAIEDPFDLNHNLGAGVSRKMTNFIMK 1253
                  ::...|:......::::             |.:.::||..||||    |::.:|.:.::
  Fly   477 PYIGQANVEIAKIERMLHARYSAYVSDNPECSIQLKKPMVVQDPIQLNHN----VTKAVTKYGLQ 537

Human  1254 AFIN 1257
            .|::
  Fly   538 TFVD 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TUT4XP_005270733.1 NT_PAP_TUTase 375..487 CDD:143392
PAP_assoc 628..677 CDD:281779
NT_PAP_TUTase 971..1089 CDD:143392 37/128 (29%)
PAP_assoc 1184..1237 CDD:281779 11/75 (15%)
PTZ00368 <1280..1375 CDD:173561
CytochromB561_N 1375..>1516 CDD:286826
DUF1421 <1383..1650 CDD:284607
FAM75 1423..>1484 CDD:291323
TailorNP_001262327.1 DUF1439 <70..126 CDD:297551
NT_PAP_TUTase 245..364 CDD:143392 34/122 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.