DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ICOSLG and zgc:172120

DIOPT Version :9

Sequence 1:XP_024307828.1 Gene:ICOSLG / 23308 HGNCID:17087 Length:473 Species:Homo sapiens
Sequence 2:NP_001121748.1 Gene:zgc:172120 / 799440 ZFINID:ZDB-GENE-080204-46 Length:273 Species:Danio rerio


Alignment Length:270 Identity:67/270 - (24%)
Similarity:122/270 - (45%) Gaps:33/270 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    11 LLFSSLRADTQEKEVRAMVGSDVELSCA-CPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLE 74
            :|.:....:..:|.:.|:.|....|.|. .|:   .:|:::.|.||..|...||.....|...||
Zfish    11 VLVAPFEVNAPDKHLLALRGHSAVLGCEFTPD---LNLSNLVVTWQREEDSQVVHSFYYQQDQLE 72

Human    75 NVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFS 139
            .....|.:|..:....:.:|:.|:|:..|:.:|..::.|:| |.:.|.... |:|||  ..|.:|
Zfish    73 RQSPEYHSRTSLFVTELHKGNASIRIAAVSWKDAGRYLCIV-SNTKGTGRA-SMEVT--YGALYS 133

Human   140 VPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSL---LDQALQNDTVFLNMRGLYDVVS 201
            .|.:|...:.|...:.|   ...|:|:|.|.|:::.|.:|   |:.....:.      |||.:.|
Zfish   134 EPRLSIHLNSSALTVEF---ETEGFPKPEVIWVDEHDQTLSCPLELLKHTED------GLYLIKS 189

Human   202 VLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLL 266
            ...: :...||:...::|.||.||:........|    :.|..||      ..||..:|:::|::
Zfish   190 RYEV-KKQVVNVTFTLKNHLLNQNIHRPVTFSYD----ENIKSNP------GTATVVVLSLVCIV 243

Human   267 VVVAVAIGWV 276
            :::.|.  |:
Zfish   244 LLIGVI--WL 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ICOSLGXP_024307828.1 V-set 20..131 CDD:311561 29/111 (26%)
Ig 153..>212 CDD:325142 13/61 (21%)
zgc:172120NP_001121748.1 IG_like 23..127 CDD:214653 29/108 (27%)
Ig 30..126 CDD:299845 26/100 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1537230at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.