DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ICOSLG and zgc:112965

DIOPT Version :9

Sequence 1:XP_024307828.1 Gene:ICOSLG / 23308 HGNCID:17087 Length:473 Species:Homo sapiens
Sequence 2:NP_001018542.1 Gene:zgc:112965 / 553735 ZFINID:ZDB-GENE-050522-10 Length:325 Species:Danio rerio


Alignment Length:216 Identity:54/216 - (25%)
Similarity:90/216 - (41%) Gaps:49/216 - (22%)


- Green bases have known domain annotations that are detailed below.


Human     1 MRLGSPGLLFLLFSSLRAD-----TQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESK 60
            :::..|.::.:....:.||     .....:.|.:|:.|.|.|...|.  ..:.|:.|.|:.::|:
Zfish    10 LKMHQPKIVLMTVMLMIADGLVVRGPSAPLSAPLGASVVLPCYVDEA--LPVEDLEVEWRRADSE 72

Human    61 TVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEV 125
            |:|..:....|..|.....|.:||......:..|:|||||.|:|.|||.::.|.|.||....:.|
Zfish    73 TLVHLYQDGESRAEVQQQDYHDRAHFFTEEIQHGNFSLRLDNLTAQDEGEYRCRVHSQQDSEETV 137

Human   126 LSVE-------------VTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRP----NVYWIN 173
            :.::             |::||.                :::|..| |::.:..|    .|.| .
Zfish   138 IKIKDVERLLVSGTNRSVSIHVG----------------EDVTLNC-SVDSHITPEHIEEVLW-R 184

Human   174 KTDNS-----LLDQALQNDTV 189
            |||..     ||.|  .|.||
Zfish   185 KTDKDGDILILLYQ--NNKTV 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ICOSLGXP_024307828.1 V-set 20..131 CDD:311561 33/123 (27%)
Ig 153..>212 CDD:325142 15/46 (33%)
zgc:112965NP_001018542.1 IG_like 36..141 CDD:214653 33/106 (31%)
Ig 44..141 CDD:299845 32/98 (33%)
V-set 151..250 CDD:284989 18/73 (25%)
IG_like 153..257 CDD:214653 18/71 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.