Sequence 1: | XP_024307828.1 | Gene: | ICOSLG / 23308 | HGNCID: | 17087 | Length: | 473 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001018542.1 | Gene: | zgc:112965 / 553735 | ZFINID: | ZDB-GENE-050522-10 | Length: | 325 | Species: | Danio rerio |
Alignment Length: | 216 | Identity: | 54/216 - (25%) |
---|---|---|---|
Similarity: | 90/216 - (41%) | Gaps: | 49/216 - (22%) |
- Green bases have known domain annotations that are detailed below.
Human 1 MRLGSPGLLFLLFSSLRAD-----TQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESK 60
Human 61 TVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEV 125
Human 126 LSVE-------------VTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRP----NVYWIN 173
Human 174 KTDNS-----LLDQALQNDTV 189 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ICOSLG | XP_024307828.1 | V-set | 20..131 | CDD:311561 | 33/123 (27%) |
Ig | 153..>212 | CDD:325142 | 15/46 (33%) | ||
zgc:112965 | NP_001018542.1 | IG_like | 36..141 | CDD:214653 | 33/106 (31%) |
Ig | 44..141 | CDD:299845 | 32/98 (33%) | ||
V-set | 151..250 | CDD:284989 | 18/73 (25%) | ||
IG_like | 153..257 | CDD:214653 | 18/71 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
NCBI | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |