Sequence 1: | XP_024307828.1 | Gene: | ICOSLG / 23308 | HGNCID: | 17087 | Length: | 473 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_611841.1 | Gene: | CG5597 / 37789 | FlyBaseID: | FBgn0034920 | Length: | 260 | Species: | Drosophila melanogaster |
Alignment Length: | 203 | Identity: | 45/203 - (22%) |
---|---|---|---|
Similarity: | 75/203 - (36%) | Gaps: | 45/203 - (22%) |
- Green bases have known domain annotations that are detailed below.
Human 19 DTQEKEVRAMVGSDVE---LSC--ACPEGSRFDLNDVYVYWQTSESKTVV-------TYHIPQNS 71
Human 72 SLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEV------ 130
Human 131 TLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRG 195
Human 196 LYDVVSVL 203 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ICOSLG | XP_024307828.1 | V-set | 20..131 | CDD:311561 | 26/128 (20%) |
Ig | 153..>212 | CDD:325142 | 15/51 (29%) | ||
CG5597 | NP_611841.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1537230at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |