DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ICOSLG and CG5597

DIOPT Version :9

Sequence 1:XP_024307828.1 Gene:ICOSLG / 23308 HGNCID:17087 Length:473 Species:Homo sapiens
Sequence 2:NP_611841.1 Gene:CG5597 / 37789 FlyBaseID:FBgn0034920 Length:260 Species:Drosophila melanogaster


Alignment Length:203 Identity:45/203 - (22%)
Similarity:75/203 - (36%) Gaps:45/203 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    19 DTQEKEVRAMVGSDVE---LSC--ACPEGSRFDLNDVYVYWQTSESKTVV-------TYHIPQNS 71
            |..|.::..:...::|   |.|  ...|..:|    :.|.|. .:.|::.       .|.||:..
  Fly    25 DESEDKIIVLQNEEMEPTILDCDYEVEESPKF----ITVKWY-RDDKSIYQWIFGTPPYAIPEFR 84

Human    72 SLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEV------ 130
            :  .:||.|.:..  .|:....   ||.|.|.|......:.|:|.:....|.....|:|      
  Fly    85 N--EIDSTYESST--EPSKQYS---SLALINPTIATTGDYKCVVQTSLNTFSSHQRVQVIDLRNY 142

Human   131 TLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRG 195
            ||.::           |....:|....||..|.||||.:..|:..    :|...:...|:.|..|
  Fly   143 TLELS-----------HKTIHNETQLNCTVTNVYPRPTITIISND----MDVVKREPMVYENEEG 192

Human   196 LYDVVSVL 203
            .:|..:|:
  Fly   193 YFDGSAVV 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ICOSLGXP_024307828.1 V-set 20..131 CDD:311561 26/128 (20%)
Ig 153..>212 CDD:325142 15/51 (29%)
CG5597NP_611841.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1537230at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.