Sequence 1: | XP_024307828.1 | Gene: | ICOSLG / 23308 | HGNCID: | 17087 | Length: | 473 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001024582.1 | Gene: | him-4 / 181187 | WormBaseID: | WBGene00001863 | Length: | 5198 | Species: | Caenorhabditis elegans |
Alignment Length: | 268 | Identity: | 57/268 - (21%) |
---|---|---|---|
Similarity: | 97/268 - (36%) | Gaps: | 87/268 - (32%) |
- Green bases have known domain annotations that are detailed below.
Human 21 QEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQT-SESKTVVTYHI-------PQNSSLENVD 77
Human 78 SRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPV 142
Human 143 VSAPHSPSQDEL------TFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVS 201
Human 202 VLRIART--PSVNIGCCIENV-------LLQQNLTVGSQTGNDIGERDKI--------TENPVST 249
Human 250 GEKNAATW 257 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ICOSLG | XP_024307828.1 | V-set | 20..131 | CDD:311561 | 22/117 (19%) |
Ig | 153..>212 | CDD:325142 | 16/66 (24%) | ||
him-4 | NP_001024582.1 | IG_like | 442..515 | CDD:214653 | |
IG | 527..605 | CDD:214652 | |||
Ig | 628..694 | CDD:319273 | |||
I-set | 702..789 | CDD:369462 | |||
I-set | 793..881 | CDD:369462 | |||
Ig | 899..974 | CDD:386229 | |||
I-set | 1012..1081 | CDD:369462 | |||
Ig | 1109..1172 | CDD:319273 | |||
Ig | 1196..1263 | CDD:319273 | |||
IG_like | 1277..1358 | CDD:214653 | |||
I-set | 1373..1450 | CDD:369462 | |||
Ig | 1474..1544 | CDD:386229 | |||
IGc2 | 1563..1628 | CDD:197706 | |||
Ig | 1651..1732 | CDD:386229 | 22/113 (19%) | ||
Ig | 1755..1818 | CDD:319273 | 19/75 (25%) | ||
Ig | 1839..1912 | CDD:386229 | 6/22 (27%) | ||
Ig | 1930..2002 | CDD:386229 | |||
IG_like | 2014..2095 | CDD:214653 | |||
Ig | 2094..2182 | CDD:386229 | |||
Ig | 2190..2283 | CDD:386229 | |||
I-set | 2296..2380 | CDD:369462 | |||
Ig | 2384..2471 | CDD:386229 | |||
IGc2 | 2492..2556 | CDD:197706 | |||
Ig | 2580..2654 | CDD:386229 | |||
Ig | 2686..2753 | CDD:319273 | |||
IG_like | 2768..2850 | CDD:214653 | |||
I-set | 2854..2939 | CDD:369462 | |||
IG_like | 2951..3031 | CDD:214653 | |||
I-set | 3046..3116 | CDD:369462 | |||
I-set | 3127..3213 | CDD:369462 | |||
Ig | 3217..3292 | CDD:386229 | |||
I-set | 3300..3386 | CDD:369462 | |||
I-set | 3396..3472 | CDD:369462 | |||
I-set | 3481..3569 | CDD:369462 | |||
I-set | 3591..3663 | CDD:369462 | |||
Ig | 3667..3762 | CDD:386229 | |||
Ig | 3775..3848 | CDD:386229 | |||
Ig | 3859..3947 | CDD:386229 | |||
IGc2 | 3968..4031 | CDD:197706 | |||
Ig_3 | 4045..4119 | CDD:372822 | |||
Ig_3 | 4136..4210 | CDD:372822 | |||
Ig | <4262..4314 | CDD:386229 | |||
Ig | 4318..4406 | CDD:386229 | |||
IG_like | 4418..4496 | CDD:214653 | |||
I-set | 4570..4654 | CDD:369462 | |||
I-set | 4752..4836 | CDD:369462 | |||
EGF_CA | 4996..5027 | CDD:238011 | |||
EGF_CA | 5034..5076 | CDD:214542 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |