DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ICOSLG and igcm-2

DIOPT Version :9

Sequence 1:XP_024307828.1 Gene:ICOSLG / 23308 HGNCID:17087 Length:473 Species:Homo sapiens
Sequence 2:NP_001362087.1 Gene:igcm-2 / 180913 WormBaseID:WBGene00020130 Length:802 Species:Caenorhabditis elegans


Alignment Length:462 Identity:89/462 - (19%)
Similarity:149/462 - (32%) Gaps:122/462 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    46 DLNDVYVYWQTSESKTVVTYHIPQNSSLEN-----VDSRYRNRALMSPAGMLRGD---------- 95
            |..::..||    .|......:|.:.||.|     :|.|...:.::|..|..:|.          
 Worm    16 DDGEMKAYW----GKAGAPITLPCSISLFNEESFSLDWRKDGQLILSAFGQEQGHVTPTLQGRLA 76

Human    96 ----FSLRLFNVTPQDEQKFHCLVL---SQSLGFQEVLSVEVTLHVAANFSVPVVSAP------H 147
                ..:.:.:||..|...:.|:|.   .|....::.||.::.::|.     ||:.:|      |
 Worm    77 RDGFLGITIHSVTDGDAGVYQCIVTKFSKQPTRPEKGLSAKLVVNVP-----PVIISPSKNAIIH 136

Human   148 SPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFL--NM----RGLYDVVSVLRIA 206
            .....:|.|.|.: .|.|.|.:.|      |..:|.:....|..  |:    :|||..::|    
 Worm   137 KKVGADLIFECKA-EGAPSPEITW------SRNEQIISTSPVLTLSNLEEGDKGLYTCLAV---- 190

Human   207 RTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAV 271
                              |:...|.:..|:    :.|:          ||...|..|...|:...
 Worm   191 ------------------NIEGNSTSSIDV----RFTK----------ATILDLIPLNKTVIEGS 223

Human   272 AIGWVCRDRCLQHSYAGAWAVSPETELTGEFAVGSSRFWGAQGRLGCQLSFRVSKNFQKAKVPCL 336
            .:.|.|.......:.:.:|....:...|....:.|:...|       .||.:..:........|.
 Worm   224 NVFWHCHANAQATAISYSWLFEKKPIKTTSLGLRSNIRSG-------DLSLQDVRKSDSGWYTCE 281

Human   337 EQLLFLETQRSPRWCAWHFLQPPLGMGWHPGVHFVTLRWDFPNMHRSRETSARPPRSPVPSPDQG 401
            .:....||..|..:.  |...||..:..|..|..|.       ..|:...|.....:|.|:....
 Worm   282 AKNSAGETTSSTAYL--HVFYPPEPLSSHQPVQTVA-------SGRNTTVSCDVIANPTPTSYTW 337

Human   402 VQGGSRHRRPAPMGCPEWVQAPAPSPRGVSRAGPGTGAQPLWGVRS------GSGHRQLLSVAAT 460
            .:.|            .::...|.|...:|.|.||.|.  ::|.::      ||.....|.||..
 Worm   338 SKNG------------HYLPTQASSHIIISYAKPGDGG--IYGCQADNIAGKGSIVETHLIVAEP 388

Human   461 PAALVCP 467
            |...|.|
 Worm   389 PVFTVAP 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ICOSLGXP_024307828.1 V-set 20..131 CDD:311561 21/106 (20%)
Ig 153..>212 CDD:325142 15/64 (23%)
igcm-2NP_001362087.1 IG_like 23..101 CDD:214653 16/81 (20%)
Ig 124..200 CDD:386229 21/104 (20%)
IG_like 214..298 CDD:214653 14/92 (15%)
Ig_3 309..371 CDD:372822 15/82 (18%)
Ig 389..467 CDD:386229 3/7 (43%)
FN3 476..548 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.