DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FKBP15 and Fkbp39

DIOPT Version :10

Sequence 1:NP_056073.1 Gene:FKBP15 / 23307 HGNCID:23397 Length:1219 Species:Homo sapiens
Sequence 2:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster


Alignment Length:108 Identity:45/108 - (41%)
Similarity:60/108 - (55%) Gaps:11/108 - (10%)


- Green bases have known domain annotations that are detailed below.


Human   185 DLIVADGPAVEVGDSLEVAYTGWLFQNHVLGQVFDSTANKDKLLRLKLGSGKVIKGWEDGMLGMK 249
            |.:|..|...:.|..:.|.|.|.|..|:   :.|||.. |.|..:..||.|:|||||:.|:.|||
  Fly   257 DQVVGKGEEAKQGKRVSVYYIGRLQSNN---KTFDSLL-KGKPFKFALGGGEVIKGWDVGVAGMK 317

Human   250 KGGKRLLIVPPACAVGSEGV---IGWTQATDSILVFEVEVRRV 289
            .||||::..||..|.|:.|.   ||    .:|.||||||::.|
  Fly   318 VGGKRVITCPPHMAYGARGAPPKIG----PNSTLVFEVELKAV 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FKBP15NP_056073.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..66
PH-like 70..168 CDD:473070
Important for function in growth cone organization. /evidence=ECO:0000250 72..169
FKBP_C 193..286 CDD:459735 40/95 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 294..349
Atrophin-1 307..>495 CDD:460830
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 381..433
FAM184 514..710 CDD:464788
Smc <620..>882 CDD:440809
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 739..761
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 931..1219
PHA03247 <951..1164 CDD:223021
Fkbp39NP_524364.2 NPL 4..86 CDD:465511
FkpA 253..356 CDD:440311 44/106 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.