DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FKBP15 and Fkbp14

DIOPT Version :10

Sequence 1:NP_056073.1 Gene:FKBP15 / 23307 HGNCID:23397 Length:1219 Species:Homo sapiens
Sequence 2:NP_001246448.1 Gene:Fkbp14 / 37449 FlyBaseID:FBgn0010470 Length:220 Species:Drosophila melanogaster


Alignment Length:250 Identity:64/250 - (25%)
Similarity:96/250 - (38%) Gaps:80/250 - (32%)


- Green bases have known domain annotations that are detailed below.


Human   169 IAKCNSTSS--LDAVLSQDLIVADGPAVEV-------------GDSLEVAYTGWLFQNHVLGQVF 218
            ::|.|...|  |...:|..|:.|....|||             ||||.:.|||.|..:   |:.|
  Fly     1 MSKSNLVISCLLLVAISNSLVRAQDLKVEVISTPEVCEQKSKNGDSLTMHYTGTLQAD---GKKF 62

Human   219 DSTANKDKLLRLKLGSGKVIKGWEDGMLGMKKGGKRLLIVPPACAVGSEGVIGWTQATDSILVFE 283
            ||:.::|:....:||:|:|||||:.|:|.|..|.||.|.:||....|.:|. |......:.|:|:
  Fly    63 DSSFDRDQPFTFQLGAGQVIKGWDQGLLNMCVGEKRKLTIPPQLGYGDQGA-GNVIPPKATLLFD 126

Human   284 VEVRRVKFARDSGSDGHSVSSRDSAAPSPIPGADNLSADPVVSPPTSIPFK----------SGEP 338
            ||:..:..|                                  |||:..||          |.|.
  Fly   127 VELINIGNA----------------------------------PPTTNVFKEIDDNADKQLSREE 157

Human   339 ALRTKSNSLSEQLAINTSPDAVKAKLISRMAKMGQPMLPILPPQLDSNDSEIEDV 393
            .:...|..|.:|:......|:.:.|                 ..|..||..:|::
  Fly   158 VIVYVSEYLKKQMTAVEGQDSEELK-----------------NMLAENDKLVEEI 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FKBP15NP_056073.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..66
PH-like 70..168 CDD:473070
Important for function in growth cone organization. /evidence=ECO:0000250 72..169 64/249 (26%)
FKBP_C 193..286 CDD:459735 39/105 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 294..349 9/64 (14%)
Atrophin-1 307..>495 CDD:460830 16/96 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 381..433 4/12 (33%)
FAM184 514..710 CDD:464788
Smc <620..>882 CDD:440809
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 739..761
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 931..1219
PHA03247 <951..1164 CDD:223021
Fkbp14NP_001246448.1 FKBP_C 37..130 CDD:459735 37/96 (39%)
FRQ1 <142..212 CDD:444056 13/70 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.