DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FKBP15 and CG3342

DIOPT Version :9

Sequence 1:NP_056073.1 Gene:FKBP15 / 23307 HGNCID:23397 Length:1219 Species:Homo sapiens
Sequence 2:NP_572324.1 Gene:CG3342 / 31586 FlyBaseID:FBgn0029874 Length:453 Species:Drosophila melanogaster


Alignment Length:544 Identity:116/544 - (21%)
Similarity:196/544 - (36%) Gaps:144/544 - (26%)


- Green bases have known domain annotations that are detailed below.


Human     6 DEDDTDFL----SPSGGARLASLFGLDQAAAGHGNEFFQYTAPKQPKK---GQGTAAT--GNQAT 61
            |:...||.    |.||...|..:|..|.....:.:...:| .|...||   |:..|.|  ..|.|
  Fly     6 DQSYQDFFDKLRSESGPRNLRQIFEDDDRPLANESSSLRY-QPGSSKKLQAGKRPAMTRSSTQET 69

Human    62 PKTAPATMSTPTILVATAVHAYRYTNGQYVKQGKFGAA--VLGNHTAREYRILLYISQQQPVTVA 124
            ..:.||..:|   .:|..|||||.:.    ..|:.|.|  :||...|.  ::::|.|:.|.:|..
  Fly    70 GDSPPAAWNT---AIAKVVHAYRSSE----NVGRVGLALSILGEMEAS--KLIVYRSKSQVLTTL 125

Human   125 RIHVNFELMVRPNNYSTFYDDQRQNWSIMFESEKAAVEFNKQVCIAKCNSTSSLDAVLSQDLIVA 189
            ::......::...:|..||||:::.||:.|:.|....||              :..::...|.| 
  Fly   126 QLTPRGGKVILRESYLQFYDDEQRFWSLRFDKEPDEKEF--------------ITFMVKNKLPV- 175

Human   190 DGPAVEVGDSLEVAYTGWLFQNHVLGQVFDSTA---NKDKLLRLKLGSGKVIKGWEDGMLGMKKG 251
                                 .|.|.::..|::   :::.|.:::. ...|.|...:        
  Fly   176 ---------------------EHYLSEISSSSSASPSREDLSKIRT-KATVTKTTPN-------- 210

Human   252 GKRLLIVPPACAVGSEGVIGWTQATDSILVFEVEVRRVKFARDSGSDGHSVSSRDSAAPSPIP-- 314
                   ||.....|...:...:..|.    |...|..:           ..|.:....:|:|  
  Fly   211 -------PPQPQPRSRVTLPTLEKADD----EERERETE-----------TPSNEDVIVTPVPRP 253

Human   315 -GADN----LSAD--PVVSPPTSIPFKSGEP-ALRTKSNSLSEQLAINTSPDAVKAKLISRMAKM 371
             |:.|    |||.  .|.:..||    |..| |:.|....|.||.|.....:.....::..|.:|
  Fly   254 IGSSNAHRKLSASSLAVANASTS----SDTPLAVTTLDKYLDEQRASGALMEHKMDAILQAMNRM 314

Human   372 G--------QPMLPILPPQLDSNDSEIEDVNTLQGGGQPVVTPSVQPSLHPAHPALPQMTSQAPQ 428
            |        :|..|:|  :.||.|..:|....|.             :|...:.|| ....:|.:
  Fly   315 GGQSSVAPKKPSDPLL--ERDSEDEMLELEQKLL-------------NLKRENRAL-MRNLKARE 363

Human   429 PSVTGLQAPSAALMQVSSLDSHSAVSGNAQ---SFQPYAGMQAYAYP-------QASAVTSQLQP 483
            .::..|:..:.||.:...:.:....|.|||   :.|..:.....|.|       .:|...:::| 
  Fly   364 QALEDLRCSACALCEELLVQNGELKSQNAQLLLASQHISDSSTAASPAHCRNCESSSRQIAKMQ- 427

Human   484 VRPLYPAPLSQPPH-FQGSGDMAS 506
               |:.:.|.:... ||.|||.:|
  Fly   428 ---LHISALQEALRIFQKSGDSSS 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FKBP15NP_056073.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..66 9/29 (31%)
PH-like 70..168 CDD:302622 28/99 (28%)
Important for function in growth cone organization. /evidence=ECO:0000250 72..169 27/98 (28%)
FKBP_C 193..286 CDD:278674 11/95 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 294..349 16/64 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 381..433 9/51 (18%)
COG1340 511..781 CDD:224259
TIMELESS_C 589..>777 CDD:252956
SPEC 686..908 CDD:295325
DUF4515 694..871 CDD:291649
Ax_dynein_light <715..780 CDD:287215
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 739..761
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 931..1219
Extradiol_Dioxygenase_3B_like <1014..>1072 CDD:294399
CG3342NP_572324.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I5192
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.