DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FKBP15 and CG30075

DIOPT Version :10

Sequence 1:NP_056073.1 Gene:FKBP15 / 23307 HGNCID:23397 Length:1219 Species:Homo sapiens
Sequence 2:NP_725390.1 Gene:CG30075 / 246437 FlyBaseID:FBgn0050075 Length:195 Species:Drosophila melanogaster


Alignment Length:175 Identity:33/175 - (18%)
Similarity:69/175 - (39%) Gaps:50/175 - (28%)


- Green bases have known domain annotations that are detailed below.


Human   570 IIQENERLKQEILEKSNRIEEQNDKISELIERNQRYVEQSN--LMMEKRNNSLQTATENTQARVL 632
            ::.||:.      ::|...:||:| |..||.|....:.|:.  .|...|.:..|.|.|....|:.
  Fly    22 LLNENDN------DQSLSSDEQDD-IFFLIYRKAHTLFQAGKLWMRRMRYHDAQRAFEKAITRLK 79

Human   633 HA-----EQEKAK--------------------------VTEELAAATAQVSHLQLKMTAHQKKE 666
            ..     ||:..|                          |.:||...|.. :...|.:..|.:..
  Fly    80 TCKTSSFEQQCRKKDMLIALFESLMICFNKMRQSRCVCYVMKELRLLTIN-NPSALALCQHGRAL 143

Human   667 TEL------QMQLTESLKETDL---LRGQLTKVQAKLSELQETSE 702
            ::|      ::...::||:...   ::.::|::..:::||::|::
  Fly   144 SDLGKYHPSRLCYIKALKKRPRDQGIKDKITRISKRITELEDTNQ 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FKBP15NP_056073.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..66
PH-like 70..168 CDD:473070
Important for function in growth cone organization. /evidence=ECO:0000250 72..169
FKBP_C 193..286 CDD:459735
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 294..349
Atrophin-1 307..>495 CDD:460830
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 381..433
FAM184 514..710 CDD:464788 33/175 (19%)
Smc <620..>882 CDD:440809 20/123 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 739..761
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 931..1219
PHA03247 <951..1164 CDD:223021
CG30075NP_725390.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.