DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSTF2T and Saf-B

DIOPT Version :10

Sequence 1:NP_056050.1 Gene:CSTF2T / 23283 HGNCID:17086 Length:616 Species:Homo sapiens
Sequence 2:NP_733041.2 Gene:Saf-B / 42958 FlyBaseID:FBgn0039229 Length:928 Species:Drosophila melanogaster


Alignment Length:95 Identity:25/95 - (26%)
Similarity:42/95 - (44%) Gaps:4/95 - (4%)


- Green bases have known domain annotations that are detailed below.


Human    16 RSVFVGNIPYEATEEQLKDIFSEVGSVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGR 80
            |:::|..:........||.|||:.|.|:..::|.:..|...:.||:........|...:.||:..
  Fly   312 RNLWVSGLSTLTRASDLKAIFSKFGKVIGAKVVTNTRTPGTRCYGYVTMSSSADASRCIENLHRT 376

Human    81 EFSGRALRVDNAASE----KNKEELKSLGP 106
            |..||.:.|:...:|    .|.:|.|...|
  Fly   377 ELHGRIISVERTKNEIGGSLNSKEGKGKAP 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSTF2TNP_056050.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 20/77 (26%)
CSTF2_hinge 112..191 CDD:433869
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..241
PRK12323 <242..>387 CDD:481241
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..418
9 X 5 AA tandem repeats of M-E-T-R-[AG] 418..462
9 X 5 AA tandem repeats of G-[AT]-G-[MI]-Q 505..549
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 542..573
CSTF_C 572..612 CDD:464130
Saf-BNP_733041.2 SAP 11..42 CDD:460424
2A1904 <16..>270 CDD:273344
RRM_SF 311..386 CDD:473069 19/73 (26%)
SWIRM-assoc_1 <588..618 CDD:465142
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.