DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MGA and bi

DIOPT Version :9

Sequence 1:XP_005254300.1 Gene:MGA / 23269 HGNCID:14010 Length:3115 Species:Homo sapiens
Sequence 2:NP_001259238.1 Gene:bi / 31379 FlyBaseID:FBgn0000179 Length:1023 Species:Drosophila melanogaster


Alignment Length:319 Identity:125/319 - (39%)
Similarity:177/319 - (55%) Gaps:37/319 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    15 GTVAGAAPTFFVILKQPGNG-------------KTDQGILVTNQDACALASSVS---SPVKSKGK 63
            |:.||..|..:     ||.|             ....|...|..:...|||:|:   .|.....:
  Fly   256 GSPAGPHPGLY-----PGGGLRFPPHHPGAHPHAHHLGSAYTTAEDVVLASAVAHQLHPAMRPLR 315

Human    64 ICLPADCTVGGIT----VTLDNNSMWNEFYHRSTEMILTKQGRRMFPYCRYWITGLDSNLKYILV 124
            ...|.|   .|:.    |||:...:|.:|:...|||::||.||:|||..::.::|||:..||||:
  Fly   316 ALQPED---DGVVDDPKVTLEGKDLWEKFHKLGTEMVITKSGRQMFPQMKFRVSGLDAKAKYILL 377

Human   125 MDISPVDNHRYKWNGRWWEPSGKAEPHVLGRVFIHPESPSTGHYWMHQPVSFYKLKLTNNTLDQE 189
            :||...|::|||::...|..:|||:|.:..|::|||:||:||..||.:.|||:|||||||..|:.
  Fly   378 LDIVAADDYRYKFHNSRWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKVVSFHKLKLTNNISDKH 442

Human   190 GHI---ILHSMHRYLPRLHLVPAEKAVEVIQLNGPGVHTFTFPQTEFFAVTAYQNIQITQLKIDY 251
            |.:   ||:|||:|.||.|||   :|.::::|......|:.|.:|||.|||||||.:|||||||.
  Fly   443 GFVSTTILNSMHKYQPRFHLV---RANDILKLPYSTFRTYVFKETEFIAVTAYQNEKITQLKIDN 504

Human   252 NPFAKGFRDDGLNNKPQRDGKQKN-SSDQEGNNISSSSGHRVRLTEGQGSEIQPGDLDP 309
            |||||||||.|...:.::.....| .||.:..|.:..|..|..|..|...  :|..|.|
  Fly   505 NPFAKGFRDTGAGKREKKQALMSNRGSDSDKLNPTHVSSSRAPLHLGHAG--RPPHLHP 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MGAXP_005254300.1 TBOX 74..264 CDD:238106 98/196 (50%)
DUF4801 1041..1087 CDD:292677
HLH 2475..2525 CDD:278439
biNP_001259238.1 Optomotor-blind <260..318 CDD:287988 12/62 (19%)
T-box 330..513 CDD:279278 94/185 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.