DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ADGRL2 and mthl1

DIOPT Version :9

Sequence 1:NP_001352934.1 Gene:ADGRL2 / 23266 HGNCID:18582 Length:1469 Species:Homo sapiens
Sequence 2:NP_001285340.1 Gene:mthl1 / 32637 FlyBaseID:FBgn0030766 Length:676 Species:Drosophila melanogaster


Alignment Length:453 Identity:112/453 - (24%)
Similarity:170/453 - (37%) Gaps:133/453 - (29%)


- Green bases have known domain annotations that are detailed below.


Human   824 ACSHLTNFAILMAHREIAYKDGVHE--------------LLLTVITWVGIVISLVCL-AICIFTF 873
            ||.||.:.|.         ..|:|:              |...|:|. ||::|:|.| |..:..|
  Fly   297 ACQHLFSSAA---------GAGIHDGSIGGTIEQANGQNLQKAVLTG-GILVSIVFLSATLVAGF 351

Human   874 CFFRGLQSDRNTIHKNLCINLFIAEFIF---LIGIDKTKYAI-----ACPIFAGLLHFFFLAAFA 930
            .    |.:..:.:|.. |...::...:|   |:.|::...::     ||...|..:.|||||||.
  Fly   352 L----LPAVHHALHWR-CQICYVTCLLFGKILLAIEELSSSLQPGSAACHTLAITMQFFFLAAFF 411

Human   931 W---MC--------------LEGVQLYLMLVEVFESEYSRKKYYYVAGYLFPATVVGVSAAIDYK 978
            |   ||              ||..|           |..|:..|.:..:..|..:..|:|.:|..
  Fly   412 WLNTMCFNIWWTFRDFRPSSLERNQ-----------EALRRYLYSLYAWGGPLLITFVAACVDQL 465

Human   979 SYGT-------EKACWLHVDNYFIWS-FIGPVTFIILLNIIFLVITLCKMVKHSNTL---KPDSS 1032
            ...|       :..||....|..|:: |.||:..::..||...|.|     .|..|.   |.|..
  Fly   466 PETTLLRPGFGQLYCWFDNRNLSIFAYFYGPIGLLLCANIALFVST-----THQLTCGLWKRDDV 525

Human  1033 RLENIKSWVLG--AFALLCLLGLTWSFGLLFINEETIV----MAYLFT-IFNAFQGVFIFIFHCA 1090
            :..:.|| .||  ...|:.::|:||...:|    ..:|    ..:.|| :.||.|||||||. ..
  Fly   526 KSSSEKS-ALGRVCLKLVVVMGVTWIADIL----SWLVGGPHGVWFFTDLINALQGVFIFIV-VG 584

Human  1091 LQKKVRKEYGKCFRHSYCCGGLPTESPHSSVKASTTRTSARYSSGTQSRIRRMWNDTVRKQSESS 1155
            .|.:|   :..| |..:|        |......:.|....::||.:|. :..|...|...|:.::
  Fly   585 CQPQV---WTAC-RRIFC--------PRLRHDITNTTNGVQHSSSSQG-LPSMAGGTEITQNTTT 636

Human  1156 FISGDINSTSTLNQGMTGNYLLTNPLLRPHGTNNPYNTLLAETVVCNAPSAPVFNSPATYRET 1218
                   :|:|.|...|            |..:||....:.|    .||.|||  :|....||
  Fly   637 -------TTTTTNTTAT------------HMPSNPAEDEVPE----KAPIAPV--APIVKMET 674

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ADGRL2NP_001352934.1 Gal_Lectin 49..129 CDD:307994
OLF 142..398 CDD:321983
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 426..460
HormR 469..533 CDD:214468
GAIN 542..764 CDD:318649
GPS 788..840 CDD:197639 5/15 (33%)
7tmB2_Latrophilin-2 848..1105 CDD:320672 79/314 (25%)
TM helix 1 850..875 CDD:320672 9/25 (36%)
TM helix 2 884..906 CDD:320672 4/24 (17%)
TM helix 3 915..942 CDD:320672 14/43 (33%)
TM helix 4 954..974 CDD:320672 3/19 (16%)
TM helix 5 991..1020 CDD:320672 9/29 (31%)
TM helix 6 1036..1063 CDD:320672 9/28 (32%)
TM helix 7 1067..1092 CDD:320672 12/29 (41%)
Latrophilin 1104..1469 CDD:308136 26/115 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1368..1410
mthl1NP_001285340.1 7tm_4 329..579 CDD:304433 71/276 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.