DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment FLT4 and drpr

DIOPT Version :9

Sequence 1:	XP_011532780.1	Gene:	FLT4 / 2324	HGNCID:	3767	Length:	1440	Species:	Homo sapiens
Sequence 2:	NP_001261276.1	Gene:	drpr / 38218	FlyBaseID:	FBgn0027594	Length:	1042	Species:	Drosophila melanogaster

Alignment Length:	132	Identity:	33/132 - (25%)
Similarity:	50/132 - (37%)	Gaps:	22/132 - (16%)

- Green bases have known domain annotations that are detailed below.

Human   341 FDWDYPGKQAERGKWVPERRSQQTHTELSSILTIH-----NVSQHDLGSYVCKANNGIQRFREST 400
            ||....|.|||........||:..:.:..|.::..     |.|.. :|||....|:.:.....:.
  Fly   853 FDNPVYGMQAETRLLPNNMRSKMNNFDQRSTMSTDYGDDCNASGR-VGSYSINYNHDLLTKNLNA 916

Human   401 EVIVHENPFISVEWLKGPILEATAGDEL-----VKLPVKLAA---YPPPEFQWYKDGKALSGRHS 457
            :   ..||.:..|.||    |....||:     .|.|||:.:   :|..|:. :.|....|....
  Fly   917 D---RTNPIVYNESLK----EEHVYDEIKHKEGYKDPVKIYSKILFPEDEYD-HLDYSRPSTSQK 973

Human   458 PH 459
            ||
  Fly   974 PH 975

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
FLT4	XP_011532780.1	Ig_2	215..301	CDD:290606
		IG_like	315..404	CDD:214653	15/67 (22%)
		Ig1_VEGFR	322..406	CDD:143270	15/69 (22%)
		IG_like	420..492	CDD:214653	13/48 (27%)
		Ig2_VEGFR-3	429..495	CDD:143271	10/34 (29%)
		IG	641..734	CDD:214652
		Ig	647..735	CDD:299845
		I-set	755..842	CDD:254352
		IGc2	770..832	CDD:197706
		PTKc_VEGFR3	914..1253	CDD:270680
		Pkinase_Tyr	922..1246	CDD:285015
drpr	NP_001261276.1	EMI	27..92	CDD:284877
		EGF_CA	274..319	CDD:304395
		DSL	<479..518	CDD:302925
		DSL	<567..606	CDD:302925
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0200
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900