DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARC and Arc2

DIOPT Version :9

Sequence 1:NP_056008.1 Gene:ARC / 23237 HGNCID:648 Length:396 Species:Homo sapiens
Sequence 2:NP_610956.1 Gene:Arc2 / 36597 FlyBaseID:FBgn0033928 Length:193 Species:Drosophila melanogaster


Alignment Length:141 Identity:37/141 - (26%)
Similarity:64/141 - (45%) Gaps:4/141 - (2%)


- Green bases have known domain annotations that are detailed below.


Human   219 EFLSHLEEYLRQVGGSEEYWLSQIQNHMNGPAKKWWEFKQGSVKNWVEFKKEFLQYSEGTLSREA 283
            ||::.:|.|....|.|::..|..:.......|..||:..:...|.|.:..:....:...|.....
  Fly    50 EFINAVETYKEVEGISDKDALKGLPLLFKSIAVVWWKGVRRDAKTWSDALQLLRDHFSPTKPSYQ 114

Human   284 IQREL-DLPQKQGEPLDQFLWRKRDLYQTLYVDA-DEEEIIQYVVGTLQPKLKRFL-RHPLPKTL 345
            |..|: :..|...|.:|.|:.::|.|...|.... |||..:.::.|.:|||.:..: ||.: ||.
  Fly   115 IYMEIFETKQSYDEVIDSFICKQRALLAKLPEGRHDEETELDFIYGLMQPKYRESIPRHEV-KTF 178

Human   346 EQLIQRGMEVQ 356
            .:|:.||..|:
  Fly   179 RELLDRGRTVE 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARCNP_056008.1 Interaction with SH3GL1 or SH3GL3. /evidence=ECO:0000250|UniProtKB:Q63053 89..100
Interaction with DNM2. /evidence=ECO:0000250|UniProtKB:Q63053 195..214
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 356..396 0/1 (0%)
Arc2NP_610956.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.