DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NBEAL2 and MET30

DIOPT Version :9

Sequence 1:XP_016861499.1 Gene:NBEAL2 / 23218 HGNCID:31928 Length:2782 Species:Homo sapiens
Sequence 2:NP_012218.1 Gene:MET30 / 854765 SGDID:S000001308 Length:640 Species:Saccharomyces cerevisiae


Alignment Length:151 Identity:42/151 - (27%)
Similarity:63/151 - (41%) Gaps:33/151 - (21%)


- Green bases have known domain annotations that are detailed below.


Human  2472 KLLFSGGHWDGSLRVTALPRGKLLSQLSCHLDVVTCLALDTCGIYLISGSRDTTCMVWRLL---- 2532
            :|||:|. :|.::.:..|..|||:.:||.|.|.|..|..|  ...||:||.|.|..||..:    
Yeast   313 RLLFTGS-YDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFD--DRKLITGSLDKTIRVWNYITGEC 374

Human  2533 ----------------HQGGLSVGLAPKPVQV----------LYGHGAAVSCVAISTELDMAVSG 2571
                            :|..:..|.|.|.|:|          |.||...|:||.:..:.....|.
Yeast   375 ISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFSCFSC 439

Human  2572 SEDGTVIIHTVRRGQFVAALR 2592
            |:|.|:.:..:|....:...|
Yeast   440 SDDTTIRMWDIRTNSCLKVFR 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NBEAL2XP_016861499.1 None
MET30NP_012218.1 F-box-like 184..228 CDD:403981
WD40 295..590 CDD:238121 42/151 (28%)
WD40 repeat 305..340 CDD:293791 10/27 (37%)
WD40 repeat 346..380 CDD:293791 10/35 (29%)
WD40 repeat 385..418 CDD:293791 6/32 (19%)
WD40 repeat 425..460 CDD:293791 7/34 (21%)
WD40 repeat 488..549 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.