DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SULF1 and CG18278

DIOPT Version :9

Sequence 1:XP_006716501.1 Gene:SULF1 / 23213 HGNCID:20391 Length:1122 Species:Homo sapiens
Sequence 2:NP_725289.1 Gene:CG18278 / 36487 FlyBaseID:FBgn0033836 Length:492 Species:Drosophila melanogaster


Alignment Length:416 Identity:156/416 - (37%)
Similarity:223/416 - (53%) Gaps:51/416 - (12%)


- Green bases have known domain annotations that are detailed below.


Human     8 LVLAVLGTELLGSLCSTVRSPRFRGRIQQERKNIRPNIILVLTDDQDVELGSLQVMNKTRKIMEH 72
            ||||.||......|                     |||:|:|:|||||||..:..|..|.:::..
  Fly    10 LVLACLGNTASEKL---------------------PNILLILSDDQDVELRGMFPMEHTIEMLGF 53

Human    73 GGATFINAFVTTPMCCPSRSSMLTGKYVHNHNVYTNNEN--CSSPSWQAMHEPRTFAVYLNNTGY 135
            |||.|.||:..:|:|||:|:|:|||.|.|||....|:.:  |..|.|:...|||.....|...||
  Fly    54 GGALFHNAYTPSPICCPARTSLLTGMYAHNHGTRNNSVSGGCYGPHWRRALEPRALPYILQQHGY 118

Human   136 RTAFFGKYLNEYNGS-YIPPGWREWLGLIKNSRFYNYTVCRNGIKEKHG-FDYAKDYFTDLITNE 198
            .|.|.|||||:|.|: .:|.||..:.||..|||:||||     ::|..| ..|...|.|||:.:.
  Fly   119 NTFFGGKYLNQYWGAGDVPKGWNHFYGLHGNSRYYNYT-----LRENSGNVHYESTYLTDLLRDR 178

Human   199 SINYFKMSKRMYPHRPVMMVISHAAPHGPEDSAPQFSKLYPNASQHITPSYNYAPNMDKHWIMQY 263
            :.::.:.:.:  ...|...:::..|.|.|...||:...::.:.....|||:|.. ..||||::: 
  Fly   179 AADFLRNATQ--SSEPFFAMVAPPAAHEPFTPAPRHEGVFSHIEALRTPSFNQV-KQDKHWLVR- 239

Human   264 TGPMLPIHMEFTNILQ---RKRLQTLMSVDDSVERLYNMLVETGELENTYIIYTADHGYHIGQFG 325
            ....||  .|..|.:.   :||.:||::||:.|..|..:|.:|..|||||||||:|:|||:|||.
  Fly   240 AARRLP--NETINTIDTYFQKRWETLLAVDELVVTLMGVLNDTQSLENTYIIYTSDNGYHVGQFA 302

Human   326 LVKGKSMPYDFDIRVPFFIRGPSVEPGSIVPQIVLNIDLAPTILDIAGLDTPPDVDGKSVLKLLD 390
            ....|..||:.||.||..||||.:.|.|.:...|..:|||||||..|.:|||..:||:|..:|| 
  Fly   303 QPFDKRQPYETDINVPLLIRGPGIAPESHIDTAVSLVDLAPTILAWADIDTPSYMDGQSFHELL- 366

Human   391 PEKPGNRFRTNKKAKI--WRDTFLVE 414
                     .||:.::  :..:.|:|
  Fly   367 ---------LNKRRRVPFFERSLLIE 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SULF1XP_006716501.1 AslA 42..>386 CDD:225661 143/350 (41%)
G6S 42..384 CDD:293766 142/348 (41%)
DUF3740 541..676 CDD:289325
ALP_like <768..817 CDD:304875
CG18278NP_725289.1 G6S 24..467 CDD:293766 149/381 (39%)
AslA 24..464 CDD:225661 149/381 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157134
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1273622at2759
OrthoFinder 1 1.000 - - FOG0001009
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.