DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Creb5 and CrebB

DIOPT Version :9

Sequence 1:XP_036021932.1 Gene:Creb5 / 231991 MGIID:2443973 Length:508 Species:Mus musculus
Sequence 2:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster


Alignment Length:355 Identity:75/355 - (21%)
Similarity:115/355 - (32%) Gaps:85/355 - (23%)


- Green bases have known domain annotations that are detailed below.


Mouse   105 VGGTMTGPGAHQLGSTRMPNHDSSVVIQQAMPSPQSSSVITQAPSTNRQIGPVPGSLSSLLHLHN 169
            |||...|.|....|:.           ||...:|||::......:||...|   |.:||:|    
  Fly    33 VGGGGGGGGGGGGGNP-----------QQQQQNPQSTTAGGPTGATNNAQG---GGVSSVL---- 79

Mouse   170 RQRQPMPASMPGTLPNPTMPGSSAVLMPM----ERQMSVNSSIMGMQGPNLSNPCASPQVQPMHS 230
                             |...:..:..|:    :..:.|.|.|.......:.....:.|.|...:
  Fly    80 -----------------TTTANCNIQYPIQTLAQHGLQVQSVIQANPSGVIQTAAGTQQQQQALA 127

Mouse   231 EAKMRLKAALTHHPAAMSNGNMSTIGHMMEMMGSRQDQTPHHHLHSHPHQHQTLPPHHPYPHQHQ 295
            .|....|......|.      .||:.|          .||.:.:    .....:||..|...:.:
  Fly   128 AATAMQKVVYVAKPP------NSTVIH----------TTPGNAV----QVRNKIPPTFPCKIKPE 172

Mouse   296 HPAHHPHPQPHHQQNHPHHHSHSHLHAHPAHHQ--TSPHPP------LPT--------------- 337
            ....||........:....|..|.|...|::::  |....|      ||.               
  Fly   173 PNTQHPEDSDESLSDDDSQHHRSELTRRPSYNKIFTEISGPDMSGASLPMSDGVLNSQLAGTGAG 237

Mouse   338 GNQAQVSPATQQMQPTQTIQPPQPTGGRRRRVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMS 402
            ||.|..|  ..|:.||..:. .:.:.......:.||...:|...|::||.||..||:|:|.::..
  Fly   238 GNAANSS--LMQLDPTYYLS-NRMSYNTNNSGIAEDQTRKREIRLQKNREAARECRRKKKEYIKC 299

Mouse   403 LEKKAEELTQTNMQLQNEVSMLKNEVAQLK 432
            ||.:...|...|..|..|:..||....|.|
  Fly   300 LENRVAVLENQNKALIEELKSLKELYCQTK 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Creb5XP_036021932.1 bZIP_ATF2 377..436 CDD:269835 20/56 (36%)
coiled coil 378..429 CDD:269835 18/50 (36%)
CrebBNP_001334685.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.