DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GSE1 and Y76B12C.4

DIOPT Version :9

Sequence 1:XP_005255916.3 Gene:GSE1 / 23199 HGNCID:28979 Length:1925 Species:Homo sapiens
Sequence 2:NP_001367986.1 Gene:Y76B12C.4 / 176998 WormBaseID:WBGene00022298 Length:252 Species:Caenorhabditis elegans


Alignment Length:256 Identity:56/256 - (21%)
Similarity:93/256 - (36%) Gaps:108/256 - (42%)


- Green bases have known domain annotations that are detailed below.


Human  1037 ERLQMDEELRRERERERERER---EREADREREKEREREREKEREQEKEREREKERERELERQR- 1097
            |:....|...:|:|:|:|:|:   :.|||:| |||.|:|.|||.:..||...|||:|:|.|:.: 
 Worm    62 EKESEKEAAEKEKEKEKEKEKTHEKNEADKE-EKEAEKEEEKEEKPPKEVTEEKEKEKEREKTKT 125

Human  1098 ----EQRAREKELLAAKALEPSFLPVAELHGLRGHATEERGKPSEQLTPTRAEKLKDAGLQAPKP 1158
                |:..||||.:..|                     ::.|..::...::.|.||         
 Worm   126 KDELEEAPREKETMEKK---------------------QKSKDEDEGDLSKEEILK--------- 160

Human  1159 VQHPLHPVPTPHHTVPSLISNHGIFSLPSSSAATALLIQRTNEEEKWLARQRRLRQEKEDRQSQV 1223
                                                 |::..::||.|..:.||:.||.|:.::.
 Worm   161 -------------------------------------IKKALKKEKKLRDRERLKTEKIDKSTET 188

Human  1224 ------------SEFRQQVLEQHLDMG---------RPPVPAEAEHRPESTTRPGPNRHEP 1263
                        |..::...|..:..|         |||.|.           |.|.:.:|
 Worm   189 KNSTTPSTEKEKSSMKKTKKEAAVATGTSGSAKKKVRPPAPP-----------PPPTKRKP 238



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.