DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FBXL7 and Ppa

DIOPT Version :9

Sequence 1:NP_036436.1 Gene:FBXL7 / 23194 HGNCID:13604 Length:491 Species:Homo sapiens
Sequence 2:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster


Alignment Length:445 Identity:123/445 - (27%)
Similarity:197/445 - (44%) Gaps:81/445 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    86 AMVHSPPPTRLTHPLIRLASRPQKEQASIDRLPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWD 150
            |...||||...||               |..|....:.|||..||...|.|.|:||..|.:.|:.
  Fly   136 ASPESPPPVEGTH---------------ISNLFPELLEQIFEHLPVRDLGRAAQVCTAWRDAAYA 185

Human   151 PRLWRTI-------RLTGETIN--VDRALK---VLTRR--------------------------- 176
            ..:|:.:       |.:....|  |.|.:|   :|:.|                           
  Fly   186 KSVWKGVEAKLHLKRSSPSLFNCLVKRGIKKVQILSLRRSLKDLVLGVPALTSLNLSGCFNVADM 250

Human   177 -----LCQDTPNVCLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSL 236
                 ...|.||    |:|:.:|.|:::||..|..|||....|..||:.||.||:|..:..:...
  Fly   251 NLGHAFSVDLPN----LKTLDLSLCKQITDTSLGRIAQHLRNLETLELGGCCNITNTGLLLIAWG 311

Human   237 CPNLEHLDVSGCSKVTCISLTREASIKLSPLHGKQISIRYLDMTDCFVLEDEGLHTIAAHCTQLT 301
            ...|:||::..|..::...:...|........| .:.:.||.:.||..|.||.|..||...|.|.
  Fly   312 LKKLKHLNLRSCWHISDQGIGHLAGFSRETAEG-NLQLEYLGLQDCQRLSDEALGHIAQGLTSLK 375

Human   302 HLYLRRCVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGLREIAKLESRLRYLSIAHCGRVTDV 366
            .:.|..||.:||.||::|. ....:::|::..|..:||.|:..:.:..|.:..|.::.|.:::|.
  Fly   376 SINLSFCVSVTDSGLKHLA-RMPKLEQLNLRSCDNISDIGMAYLTEGGSGINSLDVSFCDKISDQ 439

Human   367 GIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIGKCPLVSDTGLECLALNCFNLK 431
            .:.::|:...:||.|:...|: |||||:..:||...:|::|:||:|..::|.||:.||.:..|||
  Fly   440 ALTHIAQGLYRLRSLSLNQCQ-ITDHGMLKIAKALHELENLNIGQCSRITDKGLQTLAEDLTNLK 503

Human   432 RLSLKSCESITGQGLQIVAANCFDLQTLN-----VQDCEVSVEALRFVKRHCKRC 481
            .:.|..|..::.:|:.|: .....||.||     |: |         |...|..|
  Fly   504 TIDLYGCTQLSSKGIDII-MKLPKLQKLNLGLWLVRXC---------VHHDCNAC 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FBXL7NP_036436.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..79
F-box-like 114..157 CDD:372399 15/42 (36%)
leucine-rich repeat 129..151 CDD:275381 9/21 (43%)
leucine-rich repeat 154..187 CDD:275381 11/76 (14%)
LRR 1 170..195 8/59 (14%)
AMN1 <185..366 CDD:187754 52/180 (29%)
leucine-rich repeat 188..213 CDD:275381 10/24 (42%)
LRR 2 196..221 10/24 (42%)
leucine-rich repeat 214..234 CDD:275381 8/19 (42%)
LRR 3 222..247 7/24 (29%)
leucine-rich repeat 240..273 CDD:275381 6/32 (19%)
LRR 4 253..281 4/27 (15%)
leucine-rich repeat 274..299 CDD:275381 10/24 (42%)
LRR 5 282..307 10/24 (42%)
AMN1 297..464 CDD:187754 53/171 (31%)
leucine-rich repeat 300..325 CDD:275381 9/24 (38%)
LRR 6 308..333 8/24 (33%)
leucine-rich repeat 326..351 CDD:275381 5/24 (21%)
LRR 7 334..359 6/24 (25%)
leucine-rich repeat 352..377 CDD:275381 4/24 (17%)
LRR 8 360..385 6/24 (25%)
leucine-rich repeat 378..403 CDD:275381 11/24 (46%)
LRR 9 386..411 11/24 (46%)
leucine-rich repeat 404..429 CDD:275381 10/24 (42%)
LRR 10 412..437 10/24 (42%)
leucine-rich repeat 430..453 CDD:275381 6/22 (27%)
LRR 11 438..463 8/29 (28%)
leucine-rich repeat 456..480 CDD:275381 8/28 (29%)
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 14/40 (35%)
AMN1 <226..>334 CDD:187754 25/111 (23%)
leucine-rich repeat 236..256 CDD:275381 0/19 (0%)
leucine-rich repeat 263..288 CDD:275381 10/24 (42%)
leucine-rich repeat 289..314 CDD:275381 8/24 (33%)
leucine-rich repeat 315..347 CDD:275381 6/32 (19%)
AMN1 347..524 CDD:187754 58/179 (32%)
leucine-rich repeat 348..373 CDD:275381 10/24 (42%)
leucine-rich repeat 374..398 CDD:275381 9/24 (38%)
leucine-rich repeat 399..424 CDD:275381 5/24 (21%)
leucine-rich repeat 425..450 CDD:275381 4/24 (17%)
leucine-rich repeat 451..475 CDD:275381 11/24 (46%)
leucine-rich repeat 476..501 CDD:275381 10/24 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.