Sequence 1: | NP_001276518.1 | Gene: | Zfp12 / 231866 | MGIID: | 99157 | Length: | 686 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_731558.1 | Gene: | CG31441 / 326139 | FlyBaseID: | FBgn0051441 | Length: | 341 | Species: | Drosophila melanogaster |
Alignment Length: | 145 | Identity: | 51/145 - (35%) |
---|---|---|---|
Similarity: | 81/145 - (55%) | Gaps: | 2/145 - (1%) |
- Green bases have known domain annotations that are detailed below.
Mouse 423 RTHTGEKPYECNECGKFFSRLSYLTVHYRTHSGEKPYECAECGKSFYLNSALMRHQRVHTGEKPY 487
Mouse 488 ECNECGKLFSQLSYLTVHHRTHSGVKPYECSECGKTFYQNSALCRHRRIHRGEKPYECYICGKFF 552
Mouse 553 SQMSYLTIHH--RIH 565 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |