DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zfp12 and CG31441

DIOPT Version :9

Sequence 1:NP_001276518.1 Gene:Zfp12 / 231866 MGIID:99157 Length:686 Species:Mus musculus
Sequence 2:NP_731558.1 Gene:CG31441 / 326139 FlyBaseID:FBgn0051441 Length:341 Species:Drosophila melanogaster


Alignment Length:145 Identity:51/145 - (35%)
Similarity:81/145 - (55%) Gaps:2/145 - (1%)


- Green bases have known domain annotations that are detailed below.


Mouse   423 RTHTGEKPYECNECGKFFSRLSYLTVHYRTHSGEKPYECAECGKSFYLNSALMRHQRVHTGEKPY 487
            ||....|.:.|::||..|...:||.:|.:.|||.||:.|..|...:|.::.:.||:.:||..:||
  Fly   187 RTKRNSKSWFCDQCGGVFKSSTYLKLHLQRHSGHKPFACDICQAKYYTDNEMRRHRILHTDARPY 251

Mouse   488 ECNECGKLFSQLSYLTVHHRTHSGVKPYECSECGKTFYQNSALCRHRRIHRGEKPYECYICGKFF 552
            .|..|.|.:...|...||.|||:..:|::|..|.|.|...|...:|..:|..::.|.|.||.::|
  Fly   252 ACRFCSKTYRGCSSKVVHERTHTNERPFQCQHCDKAFTSTSTRQKHEMLHTNQRKYHCEICDQWF 316

Mouse   553 SQMSYLTIHH--RIH 565
            .:.|:||:|.  ::|
  Fly   317 LRSSHLTLHQSTKLH 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zfp12NP_001276518.1 C2H2 Zn finger 489..509 CDD:275368 7/19 (37%)
C2H2 Zn finger 517..537 CDD:275368 6/19 (32%)
C2H2 Zn finger 545..565 CDD:275368 8/21 (38%)
C2H2 Zn finger 573..593 CDD:275368
C2H2 Zn finger 601..621 CDD:275368
C2H2 Zn finger 629..649 CDD:275368
C2H2 Zn finger 657..677 CDD:275368
KRAB 8..68 CDD:214630
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..129
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..198
COG5048 251..677 CDD:227381 51/145 (35%)
C2H2 Zn finger 265..285 CDD:275368
C2H2 Zn finger 293..313 CDD:275368
C2H2 Zn finger 321..341 CDD:275368
C2H2 Zn finger 349..369 CDD:275368
C2H2 Zn finger 377..397 CDD:275368
C2H2 Zn finger 405..425 CDD:275368 1/1 (100%)
C2H2 Zn finger 433..453 CDD:275368 7/19 (37%)
C2H2 Zn finger 461..481 CDD:275368 5/19 (26%)
CG31441NP_731558.1 zf-AD 7..82 CDD:285071
COG5048 <174..337 CDD:227381 51/145 (35%)
C2H2 Zn finger 197..217 CDD:275370 7/19 (37%)
C2H2 Zn finger 225..245 CDD:275368 5/19 (26%)
C2H2 Zn finger 253..273 CDD:275368 7/19 (37%)
zf-H2C2_2 268..290 CDD:290200 10/21 (48%)
C2H2 Zn finger 281..301 CDD:275368 6/19 (32%)
C2H2 Zn finger 309..328 CDD:275368 8/18 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.