DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oasl1 and Ubi-p5E

DIOPT Version :9

Sequence 1:NP_001346874.1 Gene:Oasl1 / 231655 MGIID:2180849 Length:511 Species:Mus musculus
Sequence 2:NP_001284937.1 Gene:Ubi-p5E / 326237 FlyBaseID:FBgn0086558 Length:534 Species:Drosophila melanogaster


Alignment Length:455 Identity:106/455 - (23%)
Similarity:180/455 - (39%) Gaps:94/455 - (20%)


- Green bases have known domain annotations that are detailed below.


Mouse   109 QKRMYYCQELMDLG--LSNLSVTNRVPSSLIFTIQTRE---------TWETITVTVVPAYRALGP 162
            |:|:.:..:.::.|  ||:.::...  |:|...::.|.         |.:|||:.|       .|
  Fly   116 QQRLIFAGKQLEDGRTLSDYNIQKE--STLHLVLRLRGGMQIFVKTLTGKTITLEV-------EP 171

Mouse   163 SCPSSEVYANLIKANGYPGN-----FSPSFSELQRNFVKHRPTKLKSLLRLV---KHWYQQYVRD 219
            |.....|.|.:....|.|.:     |:....|..|....:...| :|.|.||   :...|.:|:.
  Fly   172 SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK-ESTLHLVLRLRGGMQIFVKT 235

Mouse   220 KCPRANLPPLYALELLTVYAWEAGTREDANFRLD--EG-------LATVMELLQDHELLCIYWTK 275
            ...:.          :|:....:.|.|:...::.  ||       |....:.|:|...|..|..:
  Fly   236 LTGKT----------ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 290

Mouse   276 HYTLQHPVIEACVRRQLRGQRPII------------LDPADPTNNV------AEGYRWDIVAQRA 322
            ..:..|.|:      :|||...|.            ::|:|...||      .||...|  .||.
  Fly   291 KESTLHLVL------RLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPD--QQRL 347

Mouse   323 NQCLKQDCCYDNRDSPVPSWRVKRAPDI----------QVTVQEWGHSDLTFWVNPYEPIKKLKE 377
            ....||  ..|.|  .:..:.:::...:          |:.|:......:|..|.|.:.|:.:|.
  Fly   348 IFAGKQ--LEDGR--TLSDYNIQKESTLHLVLRLRGG
MQIFVKTLTGKTITLEVEPSDTIENVKA 408

Mouse   378 KIQLSQGY-LGLQRLSFQEPGGERQLIRSHCTLAYYGIFCDTHICLLDTISPEIQVFVKNPDGRS 441
            |||..:|. ...|||.|   .|::  :....||:.|.|..::.:.|:..:...:|:|||...|::
  Fly   409 KIQDKEGIPPDQQRLIF---AGKQ--LEDGRTLSDYNIQKESTLHLVLRLRGG
MQIFVKTLTGKT 468

Mouse   442 HAYAIHPLDYVLNLKQQIEDRQGLRCQEQRLEFQGHILEDWFDFKSYGIQDSVTVILSKTTEGAA 506
            ....:.|.|.:.|:|.:|:|::|:...:|||.|.|..|||......|.||...|:.|.....|.|
  Fly   469 ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGA 533

Mouse   507  506
              Fly   534  533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Oasl1NP_001346874.1 NT_2-5OAS_ClassI-CCAase 29..208 CDD:143390 25/114 (22%)
OAS1_C 165..347 CDD:313619 43/216 (20%)
UBQ 350..429 CDD:320785 21/89 (24%)
ubiquitin 432..498 CDD:306702 23/65 (35%)
Ubi-p5ENP_001284937.1 Ubiquitin 1..76 CDD:176398
UBQ 1..72 CDD:214563
Ubiquitin 77..152 CDD:176398 8/37 (22%)
UBQ 77..148 CDD:214563 7/33 (21%)
Ubiquitin 153..228 CDD:176398 19/82 (23%)
UBQ 153..224 CDD:214563 19/78 (24%)
Ubiquitin 229..304 CDD:176398 16/90 (18%)
UBQ 229..300 CDD:214563 14/86 (16%)
Ubiquitin 305..380 CDD:176398 14/80 (18%)
UBQ 305..376 CDD:214563 14/76 (18%)
Ubiquitin 381..456 CDD:176398 21/79 (27%)
UBQ 381..452 CDD:214563 21/75 (28%)
Ubiquitin 457..532 CDD:176398 25/74 (34%)
UBQ 457..528 CDD:214563 25/70 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.