DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SNX13 and Snx27

DIOPT Version :9

Sequence 1:NP_001337791.1 Gene:SNX13 / 23161 HGNCID:21335 Length:968 Species:Homo sapiens
Sequence 2:NP_727023.1 Gene:Snx27 / 31493 FlyBaseID:FBgn0052758 Length:531 Species:Drosophila melanogaster


Alignment Length:122 Identity:36/122 - (29%)
Similarity:58/122 - (47%) Gaps:20/122 - (16%)


- Green bases have known domain annotations that are detailed below.


Human   570 YADYD-----PYAVA--GVCNDHGKTYALYAITVHRRNLNSEEMWKTYRRYSDFHDFHMRITEQF 627
            |.||.     |.::.  |:.|.:|:.|.::.|.:..|.|.|       |||.:|.:.|..:.::|
  Fly   159 YIDYSDKRSLPISIPDYGIVNRNGERYIVFNIHMAGRQLCS-------RRYREFANLHSLLRKEF 216

Human   628 ESLSSILKLPGKKTFNNMDRDFLEKRKKDLNAYLQLLLAPEMMKASPALAHYVYDFL 684
            ... :..|||||..| .:....|:.|::.|..||:.:.|..::..|.|    |.|||
  Fly   217 SGF-NFPKLPGKWPF-QLSEQQLDTRRRGLEQYLEKVCAVRVIAESDA----VQDFL 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SNX13NP_001337791.1 PXA 97..284 CDD:214611
RGS_SNX13 377..511 CDD:188674
PX_SNX13 557..687 CDD:132783 36/122 (30%)
Nexin_C 803..911 CDD:312222
Snx27NP_727023.1 PDZ_signaling 46..138 CDD:238492
PX_SNX27 165..270 CDD:132796 33/116 (28%)
UBQ 278..363 CDD:294102
FERM-like_C_SNX27 428..528 CDD:270146
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1370
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.