DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FLI1 and Ets97D

DIOPT Version :9

Sequence 1:NP_002008.2 Gene:FLI1 / 2313 HGNCID:3749 Length:452 Species:Homo sapiens
Sequence 2:NP_001263000.1 Gene:Ets97D / 43236 FlyBaseID:FBgn0004510 Length:484 Species:Drosophila melanogaster


Alignment Length:316 Identity:115/316 - (36%)
Similarity:160/316 - (50%) Gaps:65/316 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    74 NGSRESPVDCSVSKCSK------LVGGGESNPMNYNSYMDEKNGPPPPNMTTNERRVIVPADPTL 132
            :.|.|||:...:.:..|      .|.|.:..|: .|..:|.|       ....:.|:.:|.....
  Fly   148 SSSSESPIKTPLKRMHKEDSEEESVEGKDVKPV-LNWVLDSK-------FKREQIRLKIPEAANE 204

Human   133 WTQEHVRQWLEWAIKEYSLMEIDTSFFQNMDGKELCKMNKEDFLRATTLYNTEVLLSHLSYLRES 197
            ||..||..|||||:|::.|:.|:.|.:| |:|:|||.|..|:|.:........:..:||..|:|.
  Fly   205 WTHAHVTYWLEWAVKQFELVGINMSDWQ-MNGQELCAMTHEEFNQKLPRDPGNIFWTHLQLLKEC 268

Human   198 SLLAYNTTSHTDQSSRLSVKEDPSYDSVRRGAWGNNMNSGLNKSPPLGGAQTISKNT------EQ 256
            :.:   :..|    .|...:..|                   |.|.:..|.:||.|:      ||
  Fly   269 NFV---SVVH----KRAEEQRKP-------------------KQPRIMSANSISTNSGGSLSLEQ 307

Human   257 RPQPDPYQ-------ILGPTSSRLANP---------GSGQIQLWQFLLELLSDSANASCITWEGT 305
            |.....||       :...|||  .||         .:||:||||||||:|:|..:...|.|.||
  Fly   308 RIMRKSYQSVKSSDSVESTTSS--MNPSNYTTIGSGNNGQVQLWQFLLEILTDCEHTDVIEWVGT 370

Human   306 NGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFD 361
            .||||:||||.|||.|||:|:||.|||:|||||||||||.::::||.|||:|||||
  Fly   371 EGEFKLTDPDRVARLWGEKKNKPAMNYEKLSRALRYYYDGDMISKVSGKRFAYKFD 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FLI1NP_002008.2 SAM_PNT-FLI-1 114..204 CDD:188883 28/89 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 209..271 14/74 (19%)
ETS 280..363 CDD:197710 56/82 (68%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 433..452
Ets97DNP_001263000.1 GABP-alpha 48..123 CDD:288472
SAM_PNT-GABP-alpha 184..272 CDD:176084 30/98 (31%)
ETS 345..429 CDD:197710 56/82 (68%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.