Sequence 1: | NP_055909.2 | Gene: | HIC2 / 23119 | HGNCID: | 18595 | Length: | 615 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_650429.1 | Gene: | CG6654 / 41831 | FlyBaseID: | FBgn0038301 | Length: | 639 | Species: | Drosophila melanogaster |
Alignment Length: | 572 | Identity: | 125/572 - (21%) |
---|---|---|---|
Similarity: | 180/572 - (31%) | Gaps: | 223/572 - (38%) |
- Green bases have known domain annotations that are detailed below.
Human 230 CSSST-------NGSSGGCEQELGLDLSKKSPP-------------------------------- 255
Human 256 -----LPPATPG----------PHLTPD-------------------DAAQLSDSQHGSPPAASA 286
Human 287 PPVANSASYSELGGT-----PDEPMD---------------------------LEGAEDNH---- 315
Human 316 ------LSLLE------------APGGQPRKSLRHSTRKKEWGKKEPVAGSPFERREAGPKGPCP 362
Human 363 GEEGEGVGDRVP---------NGILASGAGPSGPYGEPPYPCKEEEENGKDASEDSAQSGSEGG- 417
Human 418 ---SGHASAHYM--------------------YRQEGYETVSYGDNLYVCIPCAKGFPSSEQLNA 459
Human 460 HVETHTEEELFIKEEGAYETGSGGAE-EEAEDLSAPSAAYTAEPRPFKCSVCEKTYKDPATLRQH 523
Human 524 EKTHWLTRPFPCNICGKMFTQ----------------------------RGTMTRHMRSHLGLKP 560
Human 561 FACDECGMRFTRQYRLTEHMRVHSGEKPYECQLCGGKFTQQRNLISHLRMHT 612 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
HIC2 | NP_055909.2 | BTB | 40..140 | CDD:279045 | |
BTB | 47..141 | CDD:197585 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 144..167 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 182..208 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 229..421 | 56/330 (17%) | |||
Binding to CtBP | 246..250 | 0/3 (0%) | |||
TMEM119 | <300..395 | CDD:292352 | 27/157 (17%) | ||
C2H2 Zn finger | 444..464 | CDD:275368 | 7/19 (37%) | ||
zf-C2H2 | 505..527 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 507..527 | CDD:275368 | 7/19 (37%) | ||
zf-C2H2 | 533..555 | CDD:278523 | 13/49 (27%) | ||
C2H2 Zn finger | 535..555 | CDD:275368 | 12/47 (26%) | ||
zf-H2C2_2 | 548..572 | CDD:290200 | 12/23 (52%) | ||
COG5048 | 559..>613 | CDD:227381 | 26/54 (48%) | ||
C2H2 Zn finger | 563..583 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 576..600 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 591..611 | CDD:275368 | 8/19 (42%) | ||
CG6654 | NP_650429.1 | zf-AD | 6..79 | CDD:285071 | 10/68 (15%) |
C2H2 Zn finger | 331..354 | CDD:275368 | 3/22 (14%) | ||
COG5048 | <357..570 | CDD:227381 | 65/201 (32%) | ||
C2H2 Zn finger | 360..380 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 385..406 | CDD:275370 | 4/20 (20%) | ||
C2H2 Zn finger | 414..434 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 427..451 | CDD:290200 | 13/23 (57%) | ||
C2H2 Zn finger | 442..490 | CDD:275368 | 12/47 (26%) | ||
C2H2 Zn finger | 470..487 | CDD:275368 | 1/16 (6%) | ||
zf-H2C2_2 | 482..507 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 498..518 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 510..534 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 526..546 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 539..563 | CDD:290200 | 5/9 (56%) | ||
C2H2 Zn finger | 554..574 | CDD:275368 | |||
C2H2 Zn finger | 582..602 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |