DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TTLL5 and TTLL1A

DIOPT Version :9

Sequence 1:NP_055887.3 Gene:TTLL5 / 23093 HGNCID:19963 Length:1281 Species:Homo sapiens
Sequence 2:NP_573197.2 Gene:TTLL1A / 32704 FlyBaseID:FBgn0030823 Length:496 Species:Drosophila melanogaster


Alignment Length:391 Identity:127/391 - (32%)
Similarity:195/391 - (49%) Gaps:73/391 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    54 NNIRVIGERYHLSYKIVRTDSRLVRSILTAHGFHEVHPSSTDYNLMWTGS----------HLKPF 108
            |.:|....|..:.|......|.|| |.....|:.:|...:.::|..|..:          |  |:
  Fly    45 NRLRPPKSRNGIYYSTDWDKSALV-SNFQKRGWLQVPSFNGEWNFYWACTQNCRYIFGIDH--PY 106

Human   109 LLRTLSEAQKVNHFPRSYELTRKDRLYKNIIR-----------MQHTH-----------GFKAFH 151
            .:|:   .|.:||||.|.||:|||.|.|||.|           :..:|           .:|...
  Fly   107 RMRS---DQVINHFPNSIELSRKDLLIKNIKRYRKDLERRGDPLAQSHPPDTKLGIGGTRYKHLD 168

Human   152 ILPQTFLLPAEYAEFCNSYSKD-RGPWIVKPVASSRGRGVYLINNPNQISL-------------E 202
            |:|.||:||::|..|...:.:: ...|||||.:.|:|.|:||:|..:::..             .
  Fly   169 IIPMTFVLPSDYQMFVEVFHRNPASTWIVKPCSKSQGVGIYLVNKLSKLKKFAYDARTFYPQINR 233

Human   203 ENILVSRYINNPLLIDDFKFDVRLYVLVTSYDPLVIYLYEEGLARFATVRYDQGAKNIRNQFMHL 267
            :..::|:||:|||||...|||:||:||||:::||..|||:||..||.|.:||:  ..|.|.||||
  Fly   234 DTCVISKYIDNPLLIGGKKFDLRLFVLVTTFNPLKAYLYKEGFCRFCTEKYDE--TEIDNVFMHL 296

Human   268 TNYSVNKKSGDYVSCDDPEVEDYGNKWSMSAMLRY---LKQEGRDTTALMAHVEDLIIKTIISAE 329
            ||.|:.|.:.:|.|.       :|.||.:..:..|   |:.||         |.|::...|.:..
  Fly   297 TNVSIQKTNQEYNSI-------HGGKWPLQNLWLYLDSLRGEG---------VSDMLWSRITATI 345

Human   330 LAIATACKTFVPHRSSCFELYGFDVLIDSTLKPWLLEVNLSPSLACDAPLDLKIKASMISDMFTV 394
            .....|....:.:...|||:||:|::||:.|||||:|:|.|||:......|..:|:.:|.::..|
  Fly   346 RHSLDAVAPVMANDRHCFEVYGYDIIIDNNLKPWLIEINTSPSMHSTTTNDRMLKSRLIDNVLDV 410

Human   395 V 395
            |
  Fly   411 V 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TTLL5NP_055887.3 TTL 117..395 CDD:281171 110/316 (35%)
c-MTBD region. /evidence=ECO:0000269|PubMed:25959773 378..488 5/18 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 577..614
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1072..1114
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1199..1281
TTLL1ANP_573197.2 TTL 107..419 CDD:281171 113/326 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2157
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1567
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.