DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FOXM1 and FoxL1

DIOPT Version :10

Sequence 1:NP_001400854.1 Gene:FOXM1 / 2305 HGNCID:3818 Length:802 Species:Homo sapiens
Sequence 2:NP_523912.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster


Alignment Length:90 Identity:41/90 - (45%)
Similarity:59/90 - (65%) Gaps:10/90 - (11%)


- Green bases have known domain annotations that are detailed below.


Human   235 ERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVR-- 297
            |:||:||:|:|..||:|...:|:||..||.:|.|.|||::. .|.||:|||||||||:|.||:  
  Fly    90 EKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRE-NKQGWQNSIRHNLSLNDCFVKIP 153

Human   298 -------ETSANGKVSFWTIHPSAN 315
                   :..:.||.|:|.:..||:
  Fly   154 RDKNTIEDNDSAGKGSYWMLDSSAS 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FOXM1NP_001400854.1 FH_FOXM 236..312 CDD:410803 38/84 (45%)
PHA03307 505..>750 CDD:223039
FoxL1NP_523912.1 FH_FOX 89..186 CDD:469596 41/90 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.