DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KIF21B and prp5

DIOPT Version :9

Sequence 1:NP_001239029.1 Gene:KIF21B / 23046 HGNCID:29442 Length:1637 Species:Homo sapiens
Sequence 2:NP_595604.1 Gene:prp5 / 3361260 PomBaseID:SPBP22H7.07 Length:473 Species:Schizosaccharomyces pombe


Alignment Length:397 Identity:89/397 - (22%)
Similarity:152/397 - (38%) Gaps:112/397 - (28%)


- Green bases have known domain annotations that are detailed below.


Human  1255 RLTSNQSQGSALDKSDDSDSSLS--------EVLRGI---ISPVGGAKGA----RT--------- 1295
            |..|.......:.|..|.:..::        |.::|:   ...:.|...|    ||         
pombe    85 RADSENPSSQVITKFSDPNKKIAGQVSMQSLEKIKGVPEAAHRIAGESQASLVKRTLAEQIRPEW 149

Human  1296 -APLQCVSMAEGHTKPILCLDAT--DELLFTGSKDRSCKMWNLVTGQEIAALKGHPNNVVSIKYC 1357
             ||...:.:..||...:.|:|..  ::...||:.||:.|:|:|.:|.....|.||...|..:...
pombe   150 HAPWTLMRVISGHLGWVRCVDVEPGNQWFCTGAGDRTIKIWDLASGVLKLTLTGHIATVRGLAVS 214

Human  1358 SHSGLVFSV-STSYIKVWDIRDSAKCIRTLTSSGQVISGDACAATSTRAITSAQGEHQINQIALS 1421
            .....:||. ....:|.||: ::.|.||.....   :||                   :..:.|.
pombe   215 PRHPYLFSCGEDKMVKCWDL-ETNKVIRHYHGH---LSG-------------------VYALKLH 256

Human  1422 PSGTMLYAASGNAV-RIWELSRFQPVGKLTGHIGPVMCLTVTQTASQHDLVVTGSKDHYVKMFEL 1485
            |:..:|..|..:|| |:|::...|.|..|:||...|..|.|.:...|   |||||.|..:::::|
pombe   257 PTLDVLVTAGRDAVARVWDMRTRQNVHVLSGHKSTVASLAVQEFDPQ---VVTGSMDSTIRLWDL 318

Human  1486 --GECVTGTIGPTHNFEPPHYDGIECLAIQGD--ILFSGSRDNGIKKWDLDQQELIQQIPNAHKD 1546
              |:.:| |:  ||     |...:..|::..|  ...|||.|| ||.|         :.|..   
pombe   319 AAGKTLT-TL--TH-----HKKTVRALSLHPDEFTFASGSSDN-IKHW---------KFPEG--- 362

Human  1547 WVCALAFIPGRPMLLSACRAGVIKVWNVDNFTPIGEIKGHDSPINAICTNAKHI-FTASSDCRVK 1610
                 ||                          :|..:||::.:|.:..|:.:: |:.:.:..:.
pombe   363 -----AF--------------------------MGNFEGHNAIVNTLSINSDNVMFSGADNGSMC 396

Human  1611 LWNYVPG 1617
            .|::..|
pombe   397 FWDWKSG 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KIF21BNP_001239029.1 KISc_KIF4 7..371 CDD:276823
KISc 9..377 CDD:214526
Interaction with TRIM3. /evidence=ECO:0000250|UniProtKB:Q9QXL1 400..1099
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 509..538
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 552..628
PKK 660..794 CDD:289257
JAKMIP_CC3 678..806 CDD:292653
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 830..865
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 880..906
Prefoldin 954..1102 CDD:298833
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1194..1251
WD40 1305..1613 CDD:238121 75/316 (24%)
WD40 1306..>1614 CDD:225201 76/316 (24%)
WD 1 1306..1343 12/38 (32%)
WD40 repeat 1312..1346 CDD:293791 11/35 (31%)
WD 2 1346..1384 9/38 (24%)
WD40 repeat 1351..1387 CDD:293791 9/36 (25%)
WD40 repeat 1407..1450 CDD:293791 10/43 (23%)
WD 3 1410..1448 10/38 (26%)
WD 4 1451..1493 15/43 (35%)
WD40 repeat 1456..1500 CDD:293791 16/45 (36%)
WD 5 1502..1539 11/38 (29%)
WD40 repeat 1509..1541 CDD:293791 10/33 (30%)
WD 6 1543..1582 2/38 (5%)
WD40 repeat 1548..1572 CDD:293791 2/23 (9%)
WD 7 1585..1622 7/34 (21%)
prp5NP_595604.1 WD40 <143..402 CDD:225201 78/336 (23%)
WD40 155..449 CDD:238121 77/327 (24%)
WD40 repeat 168..203 CDD:293791 11/34 (32%)
WD40 repeat 209..245 CDD:293791 8/36 (22%)
WD40 repeat 250..286 CDD:293791 10/35 (29%)
WD40 repeat 293..328 CDD:293791 13/40 (33%)
WD40 repeat 334..369 CDD:293791 14/78 (18%)
WD40 repeat 375..414 CDD:293791 5/29 (17%)
WD40 repeat 424..448 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.