DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAST3 and gwl

DIOPT Version :9

Sequence 1:XP_006722762.2 Gene:MAST3 / 23031 HGNCID:19036 Length:1419 Species:Homo sapiens
Sequence 2:NP_524860.2 Gene:gwl / 45969 FlyBaseID:FBgn0260399 Length:846 Species:Drosophila melanogaster


Alignment Length:803 Identity:144/803 - (17%)
Similarity:213/803 - (26%) Gaps:480/803 - (59%)


- Green bases have known domain annotations that are detailed below.


Human   450 PESRALVGQSRRKPCESDFETIKLISNGAYGAVYL-VRHRDTRQRFAIKKINKQNLILRNQIQQV 513
            ||:.:   |:.:.|...||..||.||.||:|.|:| .::.|:::.||||.:.|..:|.:|.:.||
  Fly    42 PENHS---QNAKLPTIKDFVIIKPISRGAFGKVFLGYKNNDSKRLFAIKVMRKSEMINKNMVSQV 103

Human   514 FVERDILTFAENPFVVSMFCSFETRRHLCMVMEYVEGGDCATLLKNMGPLPVDMARLYFAETVLA 578
            ..||:.|..:.:.|.||:|.|.::..::.:||||:.|||..:||...|......||.|.||.|:|
  Fly   104 ITERNALALSRSQFCVSLFYSLQSLSYVYLVMEYMVGGDLKSLLAMFGYFDEPTARFYVAEMVMA 168

Human   579 LEYLHNYGIVHRDLKPDNLLITSLGHIKLTDFGLSKI---------------------------- 615
            |:|||.:||||||:||||:|::|.||:||||||||||                            
  Fly   169 LQYLHQHGIVHRDIKPDNMLLSSSGHVKLTDFGLSKIDMRRDLEISDLINCSPNLNARTPGQLLS 233

Human   616 -------------------------GLMSMAT--------------------------------- 622
                                     |:.|:||                                 
  Fly   234 LTSHLSFGSEKKLNDFGSVSSGQNNGMGSVATGTSHLLQAINKHSLIMELSDSEGDTSLNDAEKT 298

Human   623 ----------------------------------------------------------------- 622
                                                                             
  Fly   299 SDSKISGVSPFFSAEEANESITHTCTTNVNPQDSSSSCSFHTCNSADLSKCSPPLESKDGAAAGN 363

Human   623 ----------------------------------------------------------------- 622
                                                                             
  Fly   364 AIPSKRRVEFVLDAAPCQGCKLAEQDSSNMATNDGKHLPKIDNAIEASFEFSMVRRRSVDERNRI 428

Human   623 --------------------------------------------------------NLYEGH--- 628
                                                                    |:..|:   
  Fly   429 SKGPEDSGVSSRKGDDYSSCHLNLNSESTASSIEKNVDNLSQSKEDFSCSDYSRSYNVTNGNEMS 493

Human   629 ----------------------------------------------------------------- 628
                                                                             
  Fly   494 GINMNSPFRNLSKHFKRPDFLRGMKRKINLVNRSDNMSSMDTDGCSSSNGSTNTGLTQEIEILNI 558

Human   629 ----------------------------------------------------------------- 628
                                                                             
  Fly   559 GSSTPKKRKARSSPIRGVLKVRSLSDDEMPINHLLGPEANVANVVFSTPVSSQKLPRRDGGLLGK 623

Human   629 -----------IEKDAREFI--------------------------------------------- 637
                       ||...||..                                             
  Fly   624 LKATRFALPLSIENKKREHATADKMSGIQYHLKLSDDPTMSPINHGAGNLPKTPKNVNINTPFRT 688

Human   638 -----------DKQVCGTPEYIAPEVIFRQGYGKPVDWWAMGVVLYEFLVGCVPFFGDTPEELFG 691
                       ::::.|||:|:|||::.:||:|..|||||:||..|||:.|..||..:||:::|.
  Fly   689 PKSVRRGARVSNERILGTPDYLAPELLLKQGHGPAVDWWALGVCFYEFMTGIPPFNDETPQKVFD 753

Human   692 QVVSDEIMWPEGDEALPADAQDLITRLLRQSPLDRLGTGGTHEVKQHPFFLALDWAGLLRHKAEF 756
            .:::..|.||||||||..::.:.:..||...|.:|   ....||:|...|..:||..:...:..|
  Fly   754 NILNKNIEWPEGDEALSVESMEAVELLLTMDPNER---PAAKEVQQMRHFACIDWENIGNTEPPF 815

Human   757 VPQLEAEDDTSYFDTRSERYRHL 779
            ||..:...||.|||.|: ..:||
  Fly   816 VPTPDNPTDTGYFDARN-NLQHL 837

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAST3XP_006722762.2 DUF1908 152..432 CDD:286070
STKc_MAST 467..746 CDD:270760 127/751 (17%)
S_TKc 468..741 CDD:214567 125/745 (17%)
PDZ 1052..1133 CDD:214570
gwlNP_524860.2 STKc_MASTL 52..>255 CDD:270761 75/202 (37%)
S_TKc 57..>205 CDD:214567 71/147 (48%)
PKc_like <655..835 CDD:304357 54/183 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0606
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.