DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBM34 and Rb97D

DIOPT Version :9

Sequence 1:NP_055829.2 Gene:RBM34 / 23029 HGNCID:28965 Length:430 Species:Homo sapiens
Sequence 2:NP_001014671.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster


Alignment Length:242 Identity:56/242 - (23%)
Similarity:108/242 - (44%) Gaps:34/242 - (14%)


- Green bases have known domain annotations that are detailed below.


Human   152 VADRKILDDTEDTVVSQRKKIQINQEEE---RLKNERTVFVGNLPVTCNKKKLKSFFKEYGQIES 213
            |.|..:.|::.|.:|      ..::||:   .|::.|.:|:|.|.....::.||.|:.::|::..
  Fly     2 VKDEPLSDESADVIV------LADREEDDICELEHLRKLFIGGLAPYTTEENLKLFYGQWGKVVD 60

Human   214 VRFRSLIPAEGTLSKKLAAIKRKIHPDQKNINAYVVFKEESAATQALKRNGAQIADGFRIRVDLA 278
            |           :..:.||.||      .....::.:.:.....:| :.|...|.||..:....|
  Fly    61 V-----------VVMRDAATKR------SRGFGFITYTKSLMVDRA-QENRPHIIDGKTVEAKRA 107

Human   279 SETSSRDKR-------SVFVGNLPYKVEESAIEKHFLDCGSIMAVRIVRDKMTGIGKGFGYVLFE 336
            .....|:.|       .:|||.|....:|..:.::||..|::::|:::.||.||..:||.:|.|:
  Fly   108 LPRPERESRETNISVKKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFD 172

Human   337 NTDSVHLALKLNNSELMGRKLRVMRSVNKEKFKQQNSNPRLKNVSKP 383
            :.|:|..|:......:....:.|.:|:.....|::.....|.|..||
  Fly   173 DYDAVDKAILKKQHAIKYVHVDVKKSIYNLDKKEKQQPGGLANAIKP 219

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
RBM34NP_055829.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..123