DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FOXJ1 and FoxK

DIOPT Version :9

Sequence 1:NP_001445.2 Gene:FOXJ1 / 2302 HGNCID:3816 Length:421 Species:Homo sapiens
Sequence 2:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster


Alignment Length:421 Identity:113/421 - (26%)
Similarity:171/421 - (40%) Gaps:115/421 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    53 PPGGTDPHGYHQVPGSAAPG--SPLAADPACLGQPHTPGKPTSSCTSRSAPPG------LQAPP- 108
            ||.|.   ..|.:.|. .||  |||........|......||.:.::.::.|.      :|..| 
  Fly   366 PPAGA---AAHLIAGD-GPGIYSPLKISIPKKEQKSPYLSPTGTISAANSCPASPRQGFIQNQPN 426

Human   109 ----------------PDDVDYATNPHVKPPYSYATLICMAMQASKATKITLSAIYKWITDNFCY 157
                            |....|  |.:.|||||||.||..|:.|:...::|||.||.:|..::.|
  Fly   427 NYNNYGNNNTQDLFQTPSTASY--NHNEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPY 489

Human   158 FR-HADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIH 221
            :| ..:..||||||||||||:.||||.|.:||||||.||||||....:|:..::||||       
  Fly   490 YRKETNKGWQNSIRHNLSLNRYFIKVARSQDEPGKGSFWRIDPDSGAKLIDHSYKKRR------- 547

Human   222 PAFARQAAQEPSAVPRAGPLTV----NTEAQQLLRE--FEEATGEAGWGAGE----------GRL 270
             ..:.|..:.|..:||:.|::.    |:.....|::  .:.|.|..|....:          .:.
  Fly   548 -QRSSQGFRPPYGMPRSAPVSPSHMDNSRESSPLQDIVLQSAPGSPGMSLEQRAADPEIIYNSQN 611

Human   271 GHKRKQPLPKRVAKVPRPPSTL---------------------LPTPEEQGELEPLKGNFDWEAI 314
            .|:::|...::     :...||                     :.||:...|.....|       
  Fly   612 AHQQQQQQQQQ-----QQQQTLSNNSNQYSSGSPYYVTNQSSGVATPQTHVEGSAASG------- 664

Human   315 FDAGTLGGELGALEALELSPPL--SPASHVDVDLTIHGRHIDCPATWGPSVEQAADSLDFDETFL 377
               |..||.:|||.||:.:..:  ..:.|     |:|.:.        ...:|....:.::|  |
  Fly   665 ---GGGGGGVGALLALKRNHVMGGGASQH-----TLHQQQ--------AVAQQQHSEIIYEE--L 711

Human   378 ATSFLQHPWDESGSGCLPPEPLFEAGDATLA 408
            .|.:..| .:.|...|:.     .|.|||:|
  Fly   712 PTDYSGH-IEASEEECVT-----TATDATVA 736

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FOXJ1NP_001445.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..116 18/87 (21%)
Forkhead 121..205 CDD:306709 48/84 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 261..302 7/71 (10%)
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 49/86 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.