DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STK38L and wts

DIOPT Version :9

Sequence 1:XP_024304657.1 Gene:STK38L / 23012 HGNCID:17848 Length:521 Species:Homo sapiens
Sequence 2:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster


Alignment Length:484 Identity:203/484 - (41%)
Similarity:294/484 - (60%) Gaps:55/484 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    25 KLTLENFYSNLILQHEERETRQKKLEVAMEEEGLADEEKKLRRSQHARKETEFLRLKRTRLGLDD 89
            |..:|....|:|..:.:|..|:.:||..|.:.||.|:.:...|....:||:.::||||.::....
  Fly   654 KFFMEQHIENVIKSYRQRTYRKNQLEKEMHKVGLPDQTQIEMRKMLNQKESNYIRLKRAKMDKSM 718

Human    90 FESLKVIGRGAFGEVRLVQKKDT-GHIYAMKILRKSDMLEKEQVAHIRAERDILVEADGAWVVKM 153
            |..||.||.||||||.||.|.|| .|:||||.|||:|:|::.||||::||||||.|||..||||:
  Fly   719 FVKLKPIGVGAFGEVTLVSKIDTSNHLYAMKTLRKADVLKRNQVAHVKAERDILAEADNNWVVKL 783

Human   154 FYSFQDKRNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYISETVLAIDAIHQLGFIHRDIKPDN 218
            :||||||.|||.:|:::||||:|:||:|.....||..:|||:|...|:|::|::|||||||||||
  Fly   784 YYSFQDKDNLYFVMDYIPGGDLMSLLIKLGIFEEELARFYIAEVTCAVDSVHKMGFIHRDIKPDN 848

Human   219 LLLDAKGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFCKFGCCFSSFPWLRYCREQKVLSLS 283
            :|:|..||:||:|||||||.:..|.:::|:...::...|        |..||..|....      
  Fly   849 ILIDRDGHIKLTDFGLCTGFRWTHNSKYYQENGNHSRQD--------SMEPWEEYSENG------ 899

Human   284 PLLNPLCFRCICIFFLWRAFFPRDYNSILLKLAFQNMNSKRKAETWKKNRRQLAYSTVGTPDYIA 348
                                 |:.  ::|         .:|:   .:.::|.||:|.||||:|||
  Fly   900 ---------------------PKP--TVL---------ERRR---MRDHQRVLAHSLVGTPNYIA 929

Human   349 PEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYRKVMNWKETLVFPPEVPISEKAKD 413
            |||..::||.:|||:||:|||:||||:|.|||.:.:|.||.:||:||::||..||:..:|.:|.|
  Fly   930 PEVLERSGYTQLCDYWSVGVILYEMLVGQPPFLANSPLETQQKVINWEKTLHIPPQAELSREATD 994

Human   414 LILRFCIDSENRIGNSGVEEIKGHPFFEGVDWEHIRERPAAIPIEIKSIDDTSNFDDF-PESDIL 477
            ||.|.|..::.|:|.| |:|:|.|.||:|:|:..:|::.|....|||...||||||.. ||....
  Fly   995 LIRRLCASADKRLGKS-VDEVKSHDFFKGIDFADMRKQKAPYIPEIKHPTDTSNFDPVDPEKLRS 1058

Human   478 QPVPNTTEPDYKSKDWV---FLNYTYKRF 503
            .....::..|....|..   |..:|::||
  Fly  1059 NDSTMSSGDDVDQNDRTFHGFFEFTFRRF 1087

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STK38LXP_024304657.1 STKc_NDR2 87..509 CDD:270776 184/422 (44%)
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 180/410 (44%)
S_TKc 719..1020 CDD:214567 161/350 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D216969at33208
OrthoFinder 1 1.000 - - FOG0000273
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.