DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAB21 and rab21

DIOPT Version :9

Sequence 1:NP_055814.1 Gene:RAB21 / 23011 HGNCID:18263 Length:225 Species:Homo sapiens
Sequence 2:NP_001070133.1 Gene:rab21 / 767727 ZFINID:ZDB-GENE-060929-1062 Length:216 Species:Danio rerio


Alignment Length:215 Identity:190/215 - (88%)
Similarity:202/215 - (93%) Gaps:0/215 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    11 AAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDT 75
            |||.|:.||||||||||||||||||||||||||||||||||||||||||||||.|||||||||||
Zfish     2 AAAGGKTYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNITGKRVNLAIWDT 66

Human    76 AGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKER 140
            |||||||||||||||||||||||||:|||||||||||||||||||||||||||||||||||||||
Zfish    67 AGQERFHALGPIYYRDSNGAILVYDVTDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKER 131

Human   141 HVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTARRGV 205
            |||::|||.|||||||||||||||.|||||||||||||||:||||::||::|||:|...|.||||
Zfish   132 HVSVEEAEGYAESVGAKHYHTSAKLNKGIEELFLDLCKRMMETAQLEERSRGNGASNSSTGRRGV 196

Human   206 QIIDDEPQAQTSGGGCCSSG 225
            ||:||||||....||||:||
Zfish   197 QIVDDEPQAAVPAGGCCTSG 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAB21NP_055814.1 Rab21 20..181 CDD:133323 154/160 (96%)
Ras 21..182 CDD:278499 154/160 (96%)
rab21NP_001070133.1 Rab21 11..172 CDD:133323 154/160 (96%)
Ras 12..173 CDD:278499 154/160 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C194343423
Domainoid 1 1.000 319 1.000 Domainoid score I6832
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8991
Inparanoid 1 1.050 397 1.000 Inparanoid score I7945
NCBI 1 1.000 - -
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1226895at2759
OrthoFinder 1 1.000 - - FOG0006095
OrthoInspector 1 1.000 - - oto46602
orthoMCL 1 0.900 - - OOG6_103363
Panther 1 1.100 - - LDO PTHR24073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4390
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.900

Return to query results.
Submit another query.